Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9ZKU5

Protein Details
Accession A0A2T9ZKU5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MYSVESNRLRHKRRRSASRLSFSSSHydrophilic
NLS Segment(s)
PositionSequence
12-14KRR
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MYSVESNRLRHKRRRSASRLSFSSSMSITNSDSSLSPYNDDLGYKQICSCGVCGKTYKHRSCLVKHLWEHHEAWNTCLKYNLSKHQQVKMMEAAQTLVSLMYFKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.86
4 0.88
5 0.88
6 0.81
7 0.76
8 0.67
9 0.57
10 0.51
11 0.4
12 0.3
13 0.22
14 0.2
15 0.15
16 0.14
17 0.13
18 0.11
19 0.11
20 0.13
21 0.16
22 0.15
23 0.15
24 0.14
25 0.16
26 0.15
27 0.15
28 0.12
29 0.13
30 0.13
31 0.12
32 0.12
33 0.11
34 0.12
35 0.12
36 0.12
37 0.13
38 0.13
39 0.14
40 0.16
41 0.18
42 0.27
43 0.37
44 0.39
45 0.38
46 0.44
47 0.48
48 0.49
49 0.55
50 0.52
51 0.5
52 0.49
53 0.52
54 0.49
55 0.48
56 0.46
57 0.42
58 0.44
59 0.36
60 0.36
61 0.37
62 0.34
63 0.31
64 0.32
65 0.29
66 0.27
67 0.33
68 0.4
69 0.41
70 0.49
71 0.53
72 0.56
73 0.61
74 0.55
75 0.54
76 0.5
77 0.45
78 0.37
79 0.33
80 0.27
81 0.21
82 0.2
83 0.15
84 0.1
85 0.07