FuNGI

Q2UQG5

Protein Details

Accession

Q2UQG5

Localization Confidence

High

Confidence Score

18.4

NoLS Segment(s)

Position	Sequence	Protein Nature
670-699	VIHIGEKPSKKQRRKEKKNKSASQTPQPEE	Hydrophilic
722-760	QTATLHKKRPFNPYKKALEAPSGVRKQKRETPGKSFTFR	Hydrophilic

NLS Segment(s)

Position	Sequence
676-690	KPSKKQRRKEKKNKS
745-750	VRKQKR

Subcellular Location(s)

nucl 19, cyto 6.5, cyto_mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR002562 3'-5'_exonuclease_dom IPR012588 Exosome-assoc_fac_Rrp6_N IPR010997 HRDC-like_sf IPR002121 HRDC_dom IPR044876 HRDC_dom_sf IPR012337 RNaseH-like_sf IPR036397 RNaseH_sf IPR045092 Rrp6-like
Gene Ontology	GO:1990342 C:heterochromatin island GO:0000176 C:nuclear exosome (RNase complex) GO:1990251 C:nuclear exosome focus GO:0140602 C:nucleolar ring GO:0005730 C:nucleolus GO:0000175 F:3'-5'-RNA exonuclease activity GO:0003676 F:nucleic acid binding GO:0000166 F:nucleotide binding GO:0000467 P:exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) GO:0071046 P:nuclear polyadenylation-dependent ncRNA catabolic process GO:0033621 P:nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts GO:1902794 P:siRNA-independent facultative heterochromatin formation
KEGG	aor:AO090005001258 -
Pfam	View protein in Pfam PF01612 DNA_pol_A_exo1 PF00570 HRDC PF08066 PMC2NT
PROSITE	View protein in PROSITE PS50967 HRDC
CDD	cd06147 Rrp6p_like_exo

Amino Acid Sequences

MDSAADFPPFQQQLTSSLVQMTRTVGQLSAEDLSFHRTSSAELSESIDEQSGRILSLTSSLLKAATAGTDLPVPTLQDEDSIEDNWRGVVDVIDALLERADACLDEFTGVIKRLSPSQQEQSAAKATKKTTSKFPTIYDYGPSKIPKPQLYFERQVDNADDSPFKPLLRTKPHAVVPLEKSVESSDRNPYETEIRAARYPESTYAVSSPVPYQPWESTTATFVDTLEGVKEMLEELKSAKEIAIDLEHHDVHSYQGLVSLMQISTRDKDWVVDTLKPWREELQMLNEVFADPSILKVFHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKRSLKFLLQKFVNFEADKRYQMADWRIRPIPEGMFDYARSDTHYLLHIFDHLRNELIENSTPENNLIDYVLEKSKDEALQRFERSPYDAATGQGPGGWYDYLSRNPAVLSKEQFAVFKAVHQWRDAVAREEDEGVQCVFPKHVLFKVAHAMPLDLGTLFRTLSPVTPIAKDRAADLLAVIKNAKIEGADGPEWRDVYVKPTRAGRSVPATETEQGLVTPPIGEENFPTAARCEVSQFWGAVLDTREPLTPPEYSAVASAEALRLSLPLPPMPRTVSEARDKLAGSAAKPAPPKPTPAPVEMPEEKEENKIFTVKGLGGPRKRKSEEAPSPEGDDSSDVIHIGEKPSKKQRRKEKKNKSASQTPQPEEKKEEAEPFNYEAADSVLHAQPAQTATLHKKRPFNPYKKALEAPSGVRKQKRETPGKSFTFR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.29
3	0.21
4	0.24
5	0.25
6	0.25
7	0.25
8	0.24
9	0.2
10	0.21
11	0.21
12	0.17
13	0.17
14	0.16
15	0.18
16	0.16
17	0.14
18	0.14
19	0.13
20	0.19
21	0.18
22	0.18
23	0.16
24	0.15
25	0.16
26	0.2
27	0.22
28	0.17
29	0.18
30	0.21
31	0.21
32	0.22
33	0.21
34	0.19
35	0.15
36	0.14
37	0.16
38	0.13
39	0.11
40	0.11
41	0.1
42	0.08
43	0.11
44	0.13
45	0.12
46	0.12
47	0.13
48	0.12
49	0.12
50	0.12
51	0.1
52	0.08
53	0.08
54	0.08
55	0.08
56	0.11
57	0.11
58	0.12
59	0.12
60	0.12
61	0.12
62	0.13
63	0.12
64	0.12
65	0.13
66	0.14
67	0.16
68	0.16
69	0.18
70	0.16
71	0.16
72	0.15
73	0.14
74	0.11
75	0.09
76	0.09
77	0.08
78	0.07
79	0.07
80	0.08
81	0.07
82	0.07
83	0.06
84	0.06
85	0.05
86	0.05
87	0.05
88	0.05
89	0.06
90	0.06
91	0.07
92	0.07
93	0.07
94	0.08
95	0.11
96	0.13
97	0.12
98	0.14
99	0.15
100	0.2
101	0.25
102	0.3
103	0.32
104	0.38
105	0.42
106	0.43
107	0.43
108	0.42
109	0.45
110	0.42
111	0.38
112	0.37
113	0.34
114	0.39
115	0.45
116	0.44
117	0.46
118	0.5
119	0.55
120	0.53
121	0.55
122	0.54
123	0.51
124	0.49
125	0.45
126	0.4
127	0.34
128	0.36
129	0.35
130	0.3
131	0.32
132	0.38
133	0.39
134	0.41
135	0.46
136	0.5
137	0.56
138	0.61
139	0.58
140	0.57
141	0.51
142	0.48
143	0.43
144	0.38
145	0.32
146	0.27
147	0.25
148	0.19
149	0.23
150	0.22
151	0.2
152	0.19
153	0.23
154	0.3
155	0.38
156	0.43
157	0.44
158	0.49
159	0.53
160	0.57
161	0.54
162	0.52
163	0.47
164	0.48
165	0.45
166	0.37
167	0.35
168	0.3
169	0.31
170	0.27
171	0.25
172	0.27
173	0.27
174	0.29
175	0.28
176	0.29
177	0.29
178	0.28
179	0.29
180	0.23
181	0.24
182	0.25
183	0.26
184	0.25
185	0.22
186	0.22
187	0.21
188	0.22
189	0.2
190	0.19
191	0.19
192	0.19
193	0.17
194	0.17
195	0.16
196	0.15
197	0.16
198	0.15
199	0.18
200	0.17
201	0.19
202	0.23
203	0.23
204	0.21
205	0.21
206	0.21
207	0.18
208	0.17
209	0.15
210	0.11
211	0.09
212	0.09
213	0.08
214	0.07
215	0.06
216	0.06
217	0.06
218	0.05
219	0.06
220	0.06
221	0.06
222	0.07
223	0.08
224	0.09
225	0.09
226	0.09
227	0.08
228	0.08
229	0.09
230	0.1
231	0.1
232	0.11
233	0.14
234	0.14
235	0.13
236	0.14
237	0.12
238	0.11
239	0.11
240	0.1
241	0.07
242	0.09
243	0.09
244	0.08
245	0.08
246	0.09
247	0.07
248	0.08
249	0.09
250	0.08
251	0.1
252	0.1
253	0.12
254	0.1
255	0.12
256	0.13
257	0.17
258	0.19
259	0.2
260	0.2
261	0.28
262	0.32
263	0.32
264	0.31
265	0.28
266	0.28
267	0.27
268	0.28
269	0.25
270	0.27
271	0.26
272	0.25
273	0.23
274	0.21
275	0.18
276	0.16
277	0.1
278	0.04
279	0.05
280	0.06
281	0.06
282	0.06
283	0.07
284	0.08
285	0.09
286	0.1
287	0.09
288	0.09
289	0.09
290	0.09
291	0.08
292	0.08
293	0.07
294	0.06
295	0.06
296	0.06
297	0.06
298	0.06
299	0.05
300	0.06
301	0.05
302	0.05
303	0.05
304	0.04
305	0.04
306	0.03
307	0.04
308	0.05
309	0.05
310	0.05
311	0.05
312	0.06
313	0.05
314	0.09
315	0.14
316	0.18
317	0.19
318	0.21
319	0.25
320	0.27
321	0.3
322	0.29
323	0.31
324	0.36
325	0.39
326	0.44
327	0.42
328	0.41
329	0.42
330	0.41
331	0.37
332	0.28
333	0.25
334	0.24
335	0.24
336	0.24
337	0.22
338	0.2
339	0.16
340	0.2
341	0.27
342	0.28
343	0.28
344	0.32
345	0.32
346	0.32
347	0.32
348	0.3
349	0.24
350	0.18
351	0.19
352	0.15
353	0.14
354	0.14
355	0.15
356	0.14
357	0.13
358	0.13
359	0.11
360	0.1
361	0.11
362	0.13
363	0.11
364	0.11
365	0.11
366	0.12
367	0.12
368	0.13
369	0.14
370	0.12
371	0.12
372	0.11
373	0.12
374	0.11
375	0.11
376	0.1
377	0.1
378	0.12
379	0.12
380	0.12
381	0.12
382	0.11
383	0.09
384	0.08
385	0.07
386	0.05
387	0.05
388	0.07
389	0.08
390	0.08
391	0.08
392	0.09
393	0.11
394	0.13
395	0.15
396	0.16
397	0.2
398	0.26
399	0.28
400	0.28
401	0.27
402	0.26
403	0.26
404	0.24
405	0.2
406	0.17
407	0.16
408	0.15
409	0.15
410	0.14
411	0.11
412	0.11
413	0.1
414	0.07
415	0.07
416	0.06
417	0.06
418	0.08
419	0.1
420	0.11
421	0.13
422	0.13
423	0.12
424	0.12
425	0.15
426	0.16
427	0.17
428	0.18
429	0.17
430	0.19
431	0.2
432	0.2
433	0.18
434	0.18
435	0.14
436	0.13
437	0.2
438	0.22
439	0.23
440	0.23
441	0.23
442	0.21
443	0.26
444	0.25
445	0.21
446	0.18
447	0.17
448	0.17
449	0.18
450	0.17
451	0.13
452	0.13
453	0.1
454	0.09
455	0.09
456	0.09
457	0.08
458	0.08
459	0.09
460	0.1
461	0.11
462	0.14
463	0.14
464	0.15
465	0.22
466	0.21
467	0.22
468	0.2
469	0.18
470	0.16
471	0.15
472	0.14
473	0.07
474	0.07
475	0.06
476	0.06
477	0.06
478	0.06
479	0.06
480	0.06
481	0.07
482	0.1
483	0.12
484	0.13
485	0.15
486	0.17
487	0.19
488	0.2
489	0.19
490	0.18
491	0.18
492	0.17
493	0.14
494	0.12
495	0.16
496	0.14
497	0.15
498	0.14
499	0.12
500	0.12
501	0.12
502	0.12
503	0.05
504	0.06
505	0.07
506	0.12
507	0.13
508	0.13
509	0.16
510	0.17
511	0.17
512	0.16
513	0.17
514	0.12
515	0.17
516	0.23
517	0.24
518	0.25
519	0.31
520	0.34
521	0.35
522	0.36
523	0.34
524	0.34
525	0.34
526	0.33
527	0.29
528	0.3
529	0.28
530	0.27
531	0.24
532	0.17
533	0.14
534	0.14
535	0.11
536	0.08
537	0.08
538	0.06
539	0.08
540	0.08
541	0.09
542	0.08
543	0.12
544	0.13
545	0.13
546	0.14
547	0.12
548	0.14
549	0.14
550	0.13
551	0.13
552	0.12
553	0.16
554	0.17
555	0.16
556	0.15
557	0.16
558	0.15
559	0.15
560	0.15
561	0.13
562	0.12
563	0.13
564	0.14
565	0.13
566	0.15
567	0.15
568	0.13
569	0.13
570	0.14
571	0.14
572	0.14
573	0.14
574	0.13
575	0.11
576	0.11
577	0.1
578	0.09
579	0.08
580	0.08
581	0.07
582	0.07
583	0.06
584	0.08
585	0.1
586	0.12
587	0.15
588	0.17
589	0.19
590	0.21
591	0.22
592	0.26
593	0.28
594	0.31
595	0.36
596	0.36
597	0.35
598	0.36
599	0.35
600	0.3
601	0.31
602	0.27
603	0.2
604	0.27
605	0.28
606	0.29
607	0.31
608	0.33
609	0.35
610	0.35
611	0.41
612	0.36
613	0.44
614	0.43
615	0.46
616	0.49
617	0.44
618	0.51
619	0.48
620	0.47
621	0.4
622	0.39
623	0.35
624	0.35
625	0.33
626	0.27
627	0.26
628	0.24
629	0.21
630	0.2
631	0.22
632	0.18
633	0.22
634	0.28
635	0.35
636	0.41
637	0.51
638	0.56
639	0.62
640	0.65
641	0.65
642	0.63
643	0.66
644	0.68
645	0.67
646	0.67
647	0.6
648	0.6
649	0.55
650	0.48
651	0.37
652	0.28
653	0.21
654	0.16
655	0.14
656	0.1
657	0.09
658	0.11
659	0.12
660	0.14
661	0.2
662	0.22
663	0.29
664	0.4
665	0.51
666	0.59
667	0.67
668	0.75
669	0.8
670	0.89
671	0.92
672	0.93
673	0.93
674	0.95
675	0.95
676	0.93
677	0.92
678	0.89
679	0.88
680	0.86
681	0.8
682	0.79
683	0.74
684	0.7
685	0.66
686	0.61
687	0.55
688	0.5
689	0.54
690	0.48
691	0.46
692	0.44
693	0.41
694	0.39
695	0.33
696	0.29
697	0.21
698	0.18
699	0.15
700	0.12
701	0.13
702	0.13
703	0.13
704	0.13
705	0.13
706	0.15
707	0.16
708	0.16
709	0.14
710	0.17
711	0.26
712	0.36
713	0.45
714	0.48
715	0.56
716	0.61
717	0.71
718	0.77
719	0.77
720	0.79
721	0.8
722	0.82
723	0.8
724	0.79
725	0.72
726	0.68
727	0.62
728	0.59
729	0.6
730	0.6
731	0.6
732	0.61
733	0.63
734	0.64
735	0.68
736	0.72
737	0.72
738	0.72
739	0.74
740	0.78

Q2UQG5

3D AlphaFold-predicted Structure Viewer