Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YEG0

Protein Details
Accession A0A2T9YEG0   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
169-190QNKFLPNKKTIKQRIEKLIDRDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR045093  Cullin  
IPR036317  Cullin_homology_sf  
IPR001373  Cullin_N  
IPR019559  Cullin_neddylation_domain  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0031625  F:ubiquitin protein ligase binding  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00888  Cullin  
PF10557  Cullin_Nedd8  
Amino Acid Sequences MMVLSLFEEAFSTESKDIVLDYTEIEKKTGASPIELKRNLQSLACTKHKLLLKTPVSRDIADTDTFKVNMDFIPPKKVFRVPLISVASSLMSANSLENETSIDSESSFVSSSLINSHDLNEEGLTVVPDLQNLEKERMHIIDAAIVRVMKSRKKLDHQKLITETIHMVQNKFLPNKKTIKQRIEKLIDRDFIERSPSNKNVYLYIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.11
6 0.11
7 0.08
8 0.09
9 0.15
10 0.19
11 0.19
12 0.19
13 0.19
14 0.19
15 0.2
16 0.24
17 0.19
18 0.19
19 0.26
20 0.32
21 0.42
22 0.42
23 0.41
24 0.4
25 0.42
26 0.4
27 0.33
28 0.32
29 0.29
30 0.35
31 0.38
32 0.38
33 0.34
34 0.39
35 0.43
36 0.41
37 0.39
38 0.42
39 0.44
40 0.49
41 0.51
42 0.52
43 0.51
44 0.48
45 0.44
46 0.37
47 0.32
48 0.26
49 0.25
50 0.2
51 0.19
52 0.19
53 0.18
54 0.15
55 0.13
56 0.11
57 0.14
58 0.17
59 0.16
60 0.24
61 0.25
62 0.26
63 0.28
64 0.31
65 0.3
66 0.29
67 0.35
68 0.28
69 0.34
70 0.35
71 0.32
72 0.29
73 0.27
74 0.22
75 0.16
76 0.14
77 0.07
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.06
88 0.06
89 0.05
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.08
101 0.08
102 0.08
103 0.09
104 0.1
105 0.1
106 0.1
107 0.09
108 0.08
109 0.07
110 0.06
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.06
117 0.06
118 0.1
119 0.11
120 0.14
121 0.14
122 0.16
123 0.17
124 0.17
125 0.17
126 0.15
127 0.13
128 0.14
129 0.14
130 0.14
131 0.13
132 0.12
133 0.11
134 0.14
135 0.18
136 0.17
137 0.24
138 0.31
139 0.37
140 0.47
141 0.58
142 0.64
143 0.72
144 0.71
145 0.73
146 0.69
147 0.67
148 0.58
149 0.48
150 0.39
151 0.3
152 0.32
153 0.26
154 0.22
155 0.2
156 0.24
157 0.29
158 0.33
159 0.36
160 0.35
161 0.41
162 0.48
163 0.53
164 0.6
165 0.63
166 0.68
167 0.72
168 0.76
169 0.8
170 0.8
171 0.81
172 0.77
173 0.75
174 0.68
175 0.62
176 0.56
177 0.47
178 0.4
179 0.4
180 0.36
181 0.32
182 0.36
183 0.37
184 0.41
185 0.44
186 0.44