Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y1N7

Protein Details
Accession A0A2T9Y1N7   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MGRLRRSRVHKGIKDVSKKYRLRRRTKDLDQIHNDBasic
NLS Segment(s)
PositionSequence
5-25RRSRVHKGIKDVSKKYRLRRR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRVHKGIKDVSKKYRLRRRTKDLDQIHNDLGTENQETPQLPLDEDLPGLGQFYCTECSKYYTDQNSLDSHKVSKVHKRRLGQLQEYAEAMAQDASIQNGMDEEGLSGSSKSSLLALTRKNNSKNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.78
4 0.77
5 0.78
6 0.79
7 0.79
8 0.8
9 0.82
10 0.84
11 0.85
12 0.85
13 0.87
14 0.87
15 0.85
16 0.85
17 0.79
18 0.74
19 0.65
20 0.55
21 0.46
22 0.35
23 0.28
24 0.2
25 0.15
26 0.11
27 0.1
28 0.11
29 0.11
30 0.12
31 0.15
32 0.14
33 0.12
34 0.12
35 0.12
36 0.11
37 0.11
38 0.1
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.06
46 0.08
47 0.08
48 0.1
49 0.1
50 0.14
51 0.15
52 0.17
53 0.22
54 0.23
55 0.26
56 0.25
57 0.27
58 0.26
59 0.27
60 0.26
61 0.21
62 0.19
63 0.18
64 0.21
65 0.22
66 0.3
67 0.37
68 0.46
69 0.52
70 0.54
71 0.6
72 0.66
73 0.7
74 0.65
75 0.62
76 0.54
77 0.49
78 0.46
79 0.38
80 0.28
81 0.2
82 0.15
83 0.09
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.07
105 0.08
106 0.11
107 0.18
108 0.24
109 0.32
110 0.41
111 0.49
112 0.57