Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Z533

Protein Details
Accession A0A2T9Z533   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-40PTEIKNYRKGWWSKHRGRQVIIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 6, E.R. 4, golg 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007315  PIG-V/Gpi18  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0000009  F:alpha-1,6-mannosyltransferase activity  
GO:0004376  F:glycolipid mannosyltransferase activity  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF04188  Mannosyl_trans2  
Amino Acid Sequences NNMKSIFKVGDSIFDDLVPTEIKNYRKGWWSKHRGRQVIIAAILSRILVFLISQASNLAVDDYDSSFDTLFINEDALTPLEVFVKNVVKVYARWDSFYYLHIAQHGYVYEQDNAFFPMFPLLINFFAFTALFPLRAFMNEQLVMMVSGIIISNLSFVGSCVALYRLGIVLFTNENFAFLSAMLYCITPSNIFMSAIYTESTFALFSFICMRLIAEKKYYLAAFYLGLGSFTRSNCVCYVGFFIWDFFLTNYNWVYSRRVFIQRLFHVMVLALISVSGFLIFQIQGYNQFCKNIPPRDGESPWSFPMITYCISGISIYAKYDIKRFLSLSMLSSIGNIGSSGSKCSGTKKITTEETSKNKKQTKILKRNAGDDVISSIKPKSSAFLGWAIDSRFCFLSSNLLPYIYLWSFLLIVSVTTMHVQIITRFMSSLPVIYWYLAHLIFSSDSEPGGDKTTSKKIPPEASRILNIILYYSAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.2
4 0.21
5 0.14
6 0.11
7 0.14
8 0.19
9 0.22
10 0.28
11 0.3
12 0.34
13 0.43
14 0.5
15 0.55
16 0.61
17 0.69
18 0.73
19 0.81
20 0.86
21 0.83
22 0.79
23 0.77
24 0.71
25 0.66
26 0.57
27 0.48
28 0.38
29 0.31
30 0.28
31 0.2
32 0.14
33 0.08
34 0.06
35 0.05
36 0.04
37 0.05
38 0.09
39 0.09
40 0.09
41 0.1
42 0.1
43 0.1
44 0.1
45 0.09
46 0.06
47 0.06
48 0.08
49 0.09
50 0.1
51 0.1
52 0.11
53 0.1
54 0.11
55 0.11
56 0.09
57 0.1
58 0.09
59 0.09
60 0.08
61 0.09
62 0.1
63 0.1
64 0.1
65 0.09
66 0.09
67 0.11
68 0.11
69 0.11
70 0.14
71 0.17
72 0.17
73 0.18
74 0.19
75 0.18
76 0.18
77 0.24
78 0.28
79 0.25
80 0.27
81 0.28
82 0.3
83 0.29
84 0.3
85 0.29
86 0.22
87 0.22
88 0.21
89 0.2
90 0.16
91 0.17
92 0.16
93 0.12
94 0.14
95 0.16
96 0.16
97 0.16
98 0.16
99 0.15
100 0.17
101 0.16
102 0.13
103 0.11
104 0.1
105 0.1
106 0.1
107 0.1
108 0.1
109 0.1
110 0.11
111 0.11
112 0.09
113 0.09
114 0.1
115 0.08
116 0.1
117 0.09
118 0.1
119 0.09
120 0.1
121 0.1
122 0.1
123 0.13
124 0.1
125 0.14
126 0.14
127 0.14
128 0.13
129 0.13
130 0.12
131 0.1
132 0.09
133 0.04
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.03
143 0.04
144 0.05
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.06
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.07
158 0.07
159 0.09
160 0.08
161 0.09
162 0.09
163 0.09
164 0.08
165 0.07
166 0.08
167 0.05
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.07
174 0.06
175 0.07
176 0.08
177 0.08
178 0.08
179 0.08
180 0.09
181 0.09
182 0.09
183 0.09
184 0.07
185 0.07
186 0.07
187 0.08
188 0.06
189 0.06
190 0.06
191 0.06
192 0.06
193 0.09
194 0.09
195 0.09
196 0.09
197 0.09
198 0.13
199 0.15
200 0.16
201 0.15
202 0.15
203 0.15
204 0.17
205 0.17
206 0.13
207 0.1
208 0.1
209 0.08
210 0.08
211 0.08
212 0.06
213 0.07
214 0.06
215 0.07
216 0.08
217 0.08
218 0.1
219 0.1
220 0.11
221 0.11
222 0.14
223 0.13
224 0.11
225 0.15
226 0.13
227 0.13
228 0.12
229 0.12
230 0.09
231 0.09
232 0.09
233 0.06
234 0.08
235 0.07
236 0.08
237 0.08
238 0.09
239 0.1
240 0.11
241 0.14
242 0.13
243 0.15
244 0.18
245 0.23
246 0.24
247 0.27
248 0.34
249 0.32
250 0.36
251 0.35
252 0.31
253 0.25
254 0.23
255 0.19
256 0.11
257 0.1
258 0.04
259 0.03
260 0.03
261 0.03
262 0.03
263 0.02
264 0.02
265 0.02
266 0.03
267 0.04
268 0.04
269 0.05
270 0.05
271 0.1
272 0.12
273 0.15
274 0.15
275 0.16
276 0.17
277 0.23
278 0.3
279 0.31
280 0.32
281 0.34
282 0.38
283 0.43
284 0.44
285 0.42
286 0.39
287 0.36
288 0.34
289 0.31
290 0.26
291 0.2
292 0.21
293 0.18
294 0.14
295 0.11
296 0.11
297 0.09
298 0.1
299 0.1
300 0.08
301 0.09
302 0.08
303 0.08
304 0.11
305 0.12
306 0.13
307 0.17
308 0.2
309 0.19
310 0.21
311 0.22
312 0.2
313 0.22
314 0.22
315 0.2
316 0.18
317 0.17
318 0.14
319 0.14
320 0.12
321 0.09
322 0.08
323 0.06
324 0.05
325 0.07
326 0.07
327 0.09
328 0.1
329 0.12
330 0.13
331 0.17
332 0.24
333 0.25
334 0.3
335 0.32
336 0.36
337 0.4
338 0.44
339 0.47
340 0.48
341 0.55
342 0.59
343 0.61
344 0.65
345 0.66
346 0.67
347 0.69
348 0.71
349 0.72
350 0.74
351 0.78
352 0.79
353 0.75
354 0.75
355 0.7
356 0.61
357 0.5
358 0.39
359 0.33
360 0.26
361 0.23
362 0.2
363 0.17
364 0.16
365 0.17
366 0.16
367 0.15
368 0.14
369 0.15
370 0.17
371 0.21
372 0.21
373 0.2
374 0.23
375 0.22
376 0.21
377 0.2
378 0.2
379 0.16
380 0.16
381 0.16
382 0.13
383 0.21
384 0.2
385 0.24
386 0.22
387 0.22
388 0.21
389 0.2
390 0.26
391 0.18
392 0.17
393 0.13
394 0.13
395 0.13
396 0.13
397 0.13
398 0.07
399 0.07
400 0.06
401 0.07
402 0.07
403 0.07
404 0.08
405 0.07
406 0.09
407 0.09
408 0.1
409 0.13
410 0.14
411 0.13
412 0.14
413 0.14
414 0.16
415 0.15
416 0.16
417 0.12
418 0.14
419 0.15
420 0.15
421 0.15
422 0.12
423 0.15
424 0.14
425 0.14
426 0.1
427 0.12
428 0.12
429 0.13
430 0.13
431 0.11
432 0.11
433 0.12
434 0.13
435 0.12
436 0.16
437 0.16
438 0.16
439 0.22
440 0.31
441 0.35
442 0.38
443 0.43
444 0.47
445 0.57
446 0.61
447 0.64
448 0.63
449 0.62
450 0.61
451 0.57
452 0.5
453 0.41
454 0.35
455 0.27