Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Z740

Protein Details
Accession A0A2T9Z740    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-128GIGEAQKTSRKQRKERKNRLKKLRGTAKVKGLKKBasic
NLS Segment(s)
PositionSequence
97-132GEAQKTSRKQRKERKNRLKKLRGTAKVKGLKKKKEE
Subcellular Location(s) mito 19.5, cyto_mito 11.833, nucl 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences AEGTVTLRTRKFVTNRLLSRKQMILDVIHPGLAGVSKDNIREKLAAMFKTSKDFVYVFGFKLLFGGGKSTGFALIYDSLDAAKRFEPKYRLLRHGIGEAQKTSRKQRKERKNRLKKLRGTAKVKGLKKKKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.67
4 0.71
5 0.66
6 0.66
7 0.61
8 0.52
9 0.45
10 0.38
11 0.31
12 0.26
13 0.27
14 0.22
15 0.19
16 0.17
17 0.14
18 0.12
19 0.11
20 0.09
21 0.06
22 0.08
23 0.09
24 0.12
25 0.16
26 0.17
27 0.18
28 0.19
29 0.18
30 0.23
31 0.26
32 0.24
33 0.24
34 0.26
35 0.25
36 0.28
37 0.28
38 0.21
39 0.19
40 0.18
41 0.17
42 0.19
43 0.2
44 0.16
45 0.17
46 0.17
47 0.15
48 0.15
49 0.13
50 0.07
51 0.06
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.08
67 0.08
68 0.08
69 0.09
70 0.13
71 0.15
72 0.2
73 0.23
74 0.29
75 0.39
76 0.44
77 0.47
78 0.47
79 0.5
80 0.47
81 0.47
82 0.44
83 0.39
84 0.35
85 0.32
86 0.31
87 0.33
88 0.34
89 0.41
90 0.45
91 0.5
92 0.58
93 0.67
94 0.74
95 0.81
96 0.89
97 0.9
98 0.93
99 0.95
100 0.96
101 0.95
102 0.93
103 0.92
104 0.91
105 0.9
106 0.86
107 0.83
108 0.82
109 0.81
110 0.79
111 0.79
112 0.78