Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Z751

Protein Details
Accession A0A2T9Z751   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
240-273SIGLPPKKQNKVLRDKPPKLHKEQRHYLKKKAAIHydrophilic
279-301EMPEKIRKWKAEKQFLKEKSKPAHydrophilic
NLS Segment(s)
PositionSequence
245-272PKKQNKVLRDKPPKLHKEQRHYLKKKAA
283-298KIRKWKAEKQFLKEKS
Subcellular Location(s) nucl 17, mito_nucl 13.333, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences GNTVKALQHRYTVNDKTKISAWIKAHNMRNTGSWMDLQMRHPDIKLGLQEIGKIRMGCYWTAQRLAKAGLIPKMYIERCPFCNKNTPETIEHMLIECFRWNSIRHETTIFNIPRLYRTVTIDQSTNNQALNQGRNIMVGKLLGGESKETRSLLAQSRDRYSPYMKELETGRFMNGIRVVRTLILDRIKQMLKYLTVPIPNPEAAFHPTYVNGKWRDPKFSLRRQADLRKMCLLNNVEPESIGLPPKKQNKVLRDKPPKLHKEQRHYLKKKAAIENALDEMPEKIRKWKAEKQFLKEKSKPALPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.52
4 0.52
5 0.55
6 0.49
7 0.48
8 0.43
9 0.44
10 0.51
11 0.56
12 0.62
13 0.58
14 0.59
15 0.53
16 0.52
17 0.48
18 0.41
19 0.34
20 0.27
21 0.24
22 0.26
23 0.28
24 0.28
25 0.31
26 0.33
27 0.32
28 0.31
29 0.31
30 0.27
31 0.27
32 0.27
33 0.22
34 0.22
35 0.21
36 0.24
37 0.24
38 0.26
39 0.25
40 0.23
41 0.21
42 0.21
43 0.23
44 0.19
45 0.22
46 0.25
47 0.25
48 0.31
49 0.33
50 0.3
51 0.31
52 0.32
53 0.29
54 0.25
55 0.26
56 0.24
57 0.24
58 0.23
59 0.21
60 0.27
61 0.25
62 0.27
63 0.29
64 0.28
65 0.3
66 0.39
67 0.4
68 0.37
69 0.46
70 0.45
71 0.46
72 0.48
73 0.48
74 0.43
75 0.45
76 0.45
77 0.36
78 0.33
79 0.27
80 0.22
81 0.18
82 0.16
83 0.13
84 0.1
85 0.1
86 0.12
87 0.13
88 0.18
89 0.26
90 0.27
91 0.27
92 0.29
93 0.29
94 0.3
95 0.37
96 0.32
97 0.24
98 0.24
99 0.23
100 0.22
101 0.24
102 0.24
103 0.17
104 0.21
105 0.24
106 0.25
107 0.26
108 0.25
109 0.23
110 0.23
111 0.24
112 0.21
113 0.16
114 0.14
115 0.15
116 0.17
117 0.19
118 0.16
119 0.15
120 0.14
121 0.15
122 0.16
123 0.13
124 0.1
125 0.08
126 0.07
127 0.06
128 0.06
129 0.05
130 0.05
131 0.06
132 0.07
133 0.08
134 0.09
135 0.09
136 0.09
137 0.09
138 0.12
139 0.16
140 0.21
141 0.24
142 0.25
143 0.28
144 0.29
145 0.3
146 0.29
147 0.26
148 0.23
149 0.22
150 0.24
151 0.21
152 0.23
153 0.23
154 0.24
155 0.24
156 0.22
157 0.19
158 0.17
159 0.17
160 0.17
161 0.19
162 0.18
163 0.15
164 0.15
165 0.15
166 0.14
167 0.15
168 0.14
169 0.14
170 0.16
171 0.15
172 0.16
173 0.2
174 0.2
175 0.2
176 0.21
177 0.19
178 0.17
179 0.18
180 0.21
181 0.2
182 0.21
183 0.22
184 0.21
185 0.22
186 0.21
187 0.19
188 0.16
189 0.16
190 0.17
191 0.18
192 0.16
193 0.14
194 0.15
195 0.18
196 0.18
197 0.23
198 0.22
199 0.25
200 0.33
201 0.35
202 0.4
203 0.41
204 0.5
205 0.52
206 0.59
207 0.65
208 0.6
209 0.64
210 0.66
211 0.72
212 0.71
213 0.68
214 0.62
215 0.59
216 0.56
217 0.5
218 0.5
219 0.44
220 0.39
221 0.39
222 0.38
223 0.31
224 0.3
225 0.3
226 0.24
227 0.21
228 0.21
229 0.16
230 0.17
231 0.25
232 0.34
233 0.39
234 0.46
235 0.53
236 0.59
237 0.69
238 0.75
239 0.79
240 0.81
241 0.84
242 0.85
243 0.87
244 0.85
245 0.84
246 0.85
247 0.84
248 0.83
249 0.85
250 0.86
251 0.87
252 0.85
253 0.84
254 0.82
255 0.8
256 0.79
257 0.77
258 0.73
259 0.67
260 0.64
261 0.59
262 0.53
263 0.46
264 0.37
265 0.28
266 0.23
267 0.22
268 0.23
269 0.2
270 0.26
271 0.32
272 0.4
273 0.48
274 0.56
275 0.63
276 0.69
277 0.76
278 0.77
279 0.81
280 0.82
281 0.84
282 0.81
283 0.78
284 0.76