Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9ZCH2

Protein Details
Accession A0A2T9ZCH2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
329-352VRLYIGPRRSQKKKLYNISPEKFAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR001375  Peptidase_S9  
Gene Ontology GO:0008236  F:serine-type peptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00326  Peptidase_S9  
Amino Acid Sequences MILYNEEIEIEPESGNESDEYPTGTDFTINEPTMITSRLDKKWEMCLEEYTFCNGNKKKYDMPLTNLKYLEPFKFDEGRTDYPAANFGCDKVMIYNITSNTTPQVDIKLENNPSQVWASEDGGQFYYVFQNGKSDFLGKYNFKNQTKEEKCLNSKLRGSFKLTNDKVIMALESWDSPIELYEFNLSTGEKRQLKFENKGTFDEYYVPKFKTFEFQGGNGDMAERIIRYPFEFDVSKKYLLILYINTEFYENHHIDWEIKGLGYITEKYEFINKDKMLAIGAFYGGYLVNWLNGQQQDIKFKGLVSAWEYFNLASNISYKITEHLYRKSVRLYIGPRRSQKKKLYNISPEKFADKRETPMLVVNTNGNDEVPFLQAIFTIDALERKNLEYELVDTEYAAYYSLGPQSCRFFYREKIIQWIKKISKLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.12
5 0.13
6 0.14
7 0.15
8 0.13
9 0.13
10 0.13
11 0.13
12 0.13
13 0.12
14 0.16
15 0.21
16 0.21
17 0.2
18 0.2
19 0.21
20 0.22
21 0.23
22 0.19
23 0.19
24 0.27
25 0.31
26 0.35
27 0.36
28 0.37
29 0.45
30 0.49
31 0.46
32 0.41
33 0.42
34 0.42
35 0.42
36 0.4
37 0.35
38 0.33
39 0.29
40 0.36
41 0.35
42 0.39
43 0.43
44 0.47
45 0.49
46 0.54
47 0.63
48 0.59
49 0.62
50 0.64
51 0.63
52 0.63
53 0.57
54 0.49
55 0.44
56 0.42
57 0.39
58 0.32
59 0.29
60 0.28
61 0.34
62 0.34
63 0.36
64 0.38
65 0.4
66 0.4
67 0.4
68 0.36
69 0.31
70 0.36
71 0.29
72 0.25
73 0.21
74 0.17
75 0.17
76 0.16
77 0.15
78 0.11
79 0.13
80 0.12
81 0.13
82 0.16
83 0.15
84 0.18
85 0.18
86 0.17
87 0.18
88 0.18
89 0.17
90 0.14
91 0.17
92 0.16
93 0.17
94 0.19
95 0.23
96 0.25
97 0.27
98 0.27
99 0.24
100 0.24
101 0.23
102 0.21
103 0.16
104 0.16
105 0.15
106 0.19
107 0.19
108 0.19
109 0.18
110 0.18
111 0.16
112 0.14
113 0.14
114 0.11
115 0.11
116 0.09
117 0.13
118 0.13
119 0.15
120 0.15
121 0.15
122 0.14
123 0.17
124 0.23
125 0.21
126 0.25
127 0.31
128 0.4
129 0.41
130 0.44
131 0.46
132 0.51
133 0.53
134 0.54
135 0.52
136 0.51
137 0.52
138 0.57
139 0.57
140 0.52
141 0.53
142 0.55
143 0.55
144 0.5
145 0.54
146 0.51
147 0.52
148 0.56
149 0.51
150 0.49
151 0.43
152 0.4
153 0.33
154 0.26
155 0.21
156 0.1
157 0.11
158 0.07
159 0.07
160 0.07
161 0.06
162 0.06
163 0.05
164 0.05
165 0.06
166 0.05
167 0.06
168 0.07
169 0.07
170 0.08
171 0.08
172 0.08
173 0.08
174 0.11
175 0.18
176 0.2
177 0.21
178 0.25
179 0.32
180 0.38
181 0.43
182 0.47
183 0.48
184 0.46
185 0.47
186 0.45
187 0.38
188 0.33
189 0.32
190 0.26
191 0.22
192 0.23
193 0.22
194 0.2
195 0.2
196 0.19
197 0.21
198 0.2
199 0.22
200 0.2
201 0.2
202 0.22
203 0.22
204 0.21
205 0.16
206 0.14
207 0.09
208 0.07
209 0.06
210 0.04
211 0.04
212 0.05
213 0.05
214 0.05
215 0.08
216 0.08
217 0.11
218 0.12
219 0.12
220 0.19
221 0.21
222 0.21
223 0.19
224 0.19
225 0.17
226 0.17
227 0.17
228 0.11
229 0.11
230 0.12
231 0.12
232 0.12
233 0.12
234 0.11
235 0.12
236 0.19
237 0.16
238 0.14
239 0.15
240 0.16
241 0.16
242 0.16
243 0.16
244 0.09
245 0.08
246 0.08
247 0.07
248 0.08
249 0.08
250 0.09
251 0.09
252 0.1
253 0.1
254 0.11
255 0.16
256 0.17
257 0.19
258 0.25
259 0.23
260 0.24
261 0.25
262 0.25
263 0.2
264 0.18
265 0.16
266 0.09
267 0.09
268 0.07
269 0.06
270 0.06
271 0.05
272 0.04
273 0.05
274 0.05
275 0.05
276 0.05
277 0.06
278 0.09
279 0.1
280 0.11
281 0.15
282 0.18
283 0.23
284 0.24
285 0.25
286 0.22
287 0.22
288 0.23
289 0.18
290 0.18
291 0.16
292 0.19
293 0.18
294 0.18
295 0.18
296 0.16
297 0.18
298 0.16
299 0.13
300 0.1
301 0.11
302 0.12
303 0.12
304 0.13
305 0.1
306 0.12
307 0.16
308 0.21
309 0.24
310 0.28
311 0.33
312 0.36
313 0.38
314 0.39
315 0.38
316 0.35
317 0.38
318 0.4
319 0.45
320 0.52
321 0.57
322 0.62
323 0.68
324 0.73
325 0.76
326 0.78
327 0.78
328 0.79
329 0.81
330 0.82
331 0.84
332 0.88
333 0.82
334 0.78
335 0.7
336 0.65
337 0.57
338 0.5
339 0.48
340 0.4
341 0.41
342 0.39
343 0.39
344 0.34
345 0.39
346 0.38
347 0.3
348 0.29
349 0.27
350 0.23
351 0.23
352 0.22
353 0.15
354 0.12
355 0.13
356 0.13
357 0.12
358 0.11
359 0.09
360 0.09
361 0.1
362 0.11
363 0.11
364 0.09
365 0.09
366 0.1
367 0.13
368 0.15
369 0.17
370 0.16
371 0.17
372 0.19
373 0.18
374 0.18
375 0.16
376 0.17
377 0.19
378 0.2
379 0.18
380 0.16
381 0.17
382 0.16
383 0.15
384 0.13
385 0.09
386 0.08
387 0.1
388 0.15
389 0.16
390 0.18
391 0.21
392 0.26
393 0.29
394 0.31
395 0.32
396 0.31
397 0.36
398 0.44
399 0.48
400 0.46
401 0.53
402 0.61
403 0.64
404 0.66
405 0.7
406 0.65
407 0.65