Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Z9Q5

Protein Details
Accession A0A2T9Z9Q5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-112LMSLTKLKNKKLKPKARALESTPHydrophilic
NLS Segment(s)
PositionSequence
97-105KNKKLKPKA
Subcellular Location(s) mito 15, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MPPNSNLYIIFFSVSGGDFCLKLRLRKELKPFNICVNRLCKNIRYEKEHGKLKTIQTLGRSLITRMLNSKLANHNLKIEPQRIDNPSIALMSLTKLKNKKLKPKARALESTPATTAGTSYDNVVAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.09
4 0.09
5 0.09
6 0.09
7 0.17
8 0.18
9 0.23
10 0.26
11 0.34
12 0.39
13 0.46
14 0.56
15 0.59
16 0.65
17 0.66
18 0.65
19 0.65
20 0.67
21 0.61
22 0.56
23 0.52
24 0.48
25 0.45
26 0.46
27 0.4
28 0.4
29 0.48
30 0.48
31 0.49
32 0.51
33 0.57
34 0.62
35 0.64
36 0.58
37 0.53
38 0.53
39 0.47
40 0.48
41 0.4
42 0.34
43 0.28
44 0.3
45 0.26
46 0.23
47 0.22
48 0.16
49 0.19
50 0.18
51 0.17
52 0.16
53 0.18
54 0.18
55 0.18
56 0.22
57 0.21
58 0.26
59 0.28
60 0.27
61 0.3
62 0.28
63 0.32
64 0.32
65 0.31
66 0.27
67 0.28
68 0.33
69 0.31
70 0.33
71 0.28
72 0.25
73 0.22
74 0.21
75 0.17
76 0.12
77 0.1
78 0.08
79 0.14
80 0.14
81 0.19
82 0.23
83 0.3
84 0.38
85 0.46
86 0.56
87 0.61
88 0.71
89 0.73
90 0.81
91 0.83
92 0.83
93 0.81
94 0.75
95 0.74
96 0.67
97 0.61
98 0.51
99 0.43
100 0.35
101 0.28
102 0.23
103 0.15
104 0.14
105 0.11
106 0.13