Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Z676

Protein Details
Accession A0A2T9Z676    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-113SDGYSYRTRKNTRLHRLKKPQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 5, golg 4, E.R. 3, pero 2
Family & Domain DBs
Amino Acid Sequences NLCPFLYAKRLAVLIGIFMKPLSVVRVSVCASISRISSLRPSSNCKTSADSPQSKSLESFKIQMRLLFSSICNVQCSATPVKRENINTTLVFSDGYSYRTRKNTRLHRLKKPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.12
5 0.11
6 0.11
7 0.1
8 0.1
9 0.1
10 0.08
11 0.09
12 0.1
13 0.14
14 0.15
15 0.15
16 0.16
17 0.14
18 0.14
19 0.15
20 0.14
21 0.13
22 0.12
23 0.12
24 0.16
25 0.19
26 0.22
27 0.24
28 0.3
29 0.33
30 0.37
31 0.38
32 0.35
33 0.36
34 0.35
35 0.4
36 0.41
37 0.41
38 0.39
39 0.44
40 0.43
41 0.39
42 0.37
43 0.31
44 0.26
45 0.23
46 0.24
47 0.2
48 0.24
49 0.24
50 0.24
51 0.23
52 0.22
53 0.21
54 0.18
55 0.16
56 0.14
57 0.16
58 0.15
59 0.14
60 0.13
61 0.12
62 0.13
63 0.17
64 0.2
65 0.22
66 0.25
67 0.27
68 0.31
69 0.36
70 0.38
71 0.39
72 0.36
73 0.37
74 0.33
75 0.32
76 0.29
77 0.24
78 0.21
79 0.15
80 0.16
81 0.12
82 0.14
83 0.17
84 0.19
85 0.25
86 0.33
87 0.39
88 0.44
89 0.53
90 0.62
91 0.69
92 0.77
93 0.81