Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9ZB27

Protein Details
Accession A0A2T9ZB27   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
157-181GNTGHGIRKINKKKLHKIESNESNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 5.5, cyto_nucl 5, extr 4, vacu 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002933  Peptidase_M20  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF01546  Peptidase_M20  
Amino Acid Sequences QLALKKKAVALVLSVTAELCPQSLSCTNYPNEHVAIGLGFYLDTQHSQTVLRQAVQPSALILKLLFEILGSYLKMVNPCNKIQLILYLEAIRNIFHSRKKLSRNVYVVFTPDEEMCGIDGVKDFFETQDFRNLNVAFDLEEDISGVNNNQVIFMTHGNTGHGIRKINKKKLHKIESNESNLRSGEITSINLTDSNDGKQAIVVPATYSVTFDIGVSPNEDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.15
3 0.13
4 0.13
5 0.11
6 0.08
7 0.07
8 0.06
9 0.11
10 0.15
11 0.2
12 0.21
13 0.26
14 0.28
15 0.31
16 0.34
17 0.32
18 0.29
19 0.24
20 0.22
21 0.17
22 0.15
23 0.12
24 0.09
25 0.06
26 0.04
27 0.04
28 0.05
29 0.05
30 0.06
31 0.08
32 0.09
33 0.09
34 0.11
35 0.13
36 0.18
37 0.2
38 0.2
39 0.22
40 0.22
41 0.24
42 0.23
43 0.21
44 0.16
45 0.15
46 0.14
47 0.1
48 0.09
49 0.07
50 0.07
51 0.07
52 0.06
53 0.04
54 0.05
55 0.05
56 0.07
57 0.06
58 0.06
59 0.07
60 0.08
61 0.1
62 0.12
63 0.18
64 0.2
65 0.21
66 0.24
67 0.24
68 0.23
69 0.22
70 0.24
71 0.2
72 0.17
73 0.17
74 0.15
75 0.15
76 0.15
77 0.15
78 0.11
79 0.1
80 0.12
81 0.14
82 0.16
83 0.2
84 0.24
85 0.31
86 0.37
87 0.43
88 0.46
89 0.51
90 0.52
91 0.5
92 0.47
93 0.41
94 0.36
95 0.29
96 0.24
97 0.17
98 0.12
99 0.1
100 0.08
101 0.07
102 0.06
103 0.06
104 0.05
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.07
113 0.09
114 0.09
115 0.17
116 0.17
117 0.18
118 0.23
119 0.23
120 0.21
121 0.2
122 0.19
123 0.11
124 0.11
125 0.12
126 0.06
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.04
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.09
140 0.1
141 0.11
142 0.11
143 0.11
144 0.11
145 0.13
146 0.14
147 0.16
148 0.18
149 0.2
150 0.25
151 0.35
152 0.44
153 0.52
154 0.6
155 0.65
156 0.73
157 0.8
158 0.84
159 0.81
160 0.79
161 0.8
162 0.81
163 0.79
164 0.74
165 0.64
166 0.56
167 0.48
168 0.42
169 0.32
170 0.23
171 0.17
172 0.14
173 0.14
174 0.13
175 0.13
176 0.13
177 0.14
178 0.14
179 0.14
180 0.14
181 0.15
182 0.16
183 0.16
184 0.15
185 0.15
186 0.17
187 0.15
188 0.15
189 0.13
190 0.12
191 0.13
192 0.15
193 0.15
194 0.13
195 0.12
196 0.12
197 0.12
198 0.11
199 0.12
200 0.12
201 0.13
202 0.14