Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UCH9

Protein Details
Accession Q2UCH9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-23DSHLDVRQSKHKRPFRCQAWEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036930  WGR_dom_sf  
IPR008893  WGR_domain  
PROSITE View protein in PROSITE  
PS51977  WGR  
Amino Acid Sequences MDSHLDVRQSKHKRPFRCQAWEESWLQYMQSRSVMRNFSLRYSRVGKSNSQILAPAGSSLDTALVAFERFFEEYTGKSWALRGNGILPQPKRDSAGNLLPPHEGWYIYEDNTNMFLDFIQKGSASTTDAFGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.8
4 0.82
5 0.77
6 0.75
7 0.73
8 0.68
9 0.61
10 0.53
11 0.45
12 0.35
13 0.32
14 0.26
15 0.21
16 0.18
17 0.21
18 0.2
19 0.2
20 0.25
21 0.27
22 0.25
23 0.3
24 0.3
25 0.29
26 0.33
27 0.32
28 0.32
29 0.35
30 0.35
31 0.35
32 0.36
33 0.34
34 0.31
35 0.36
36 0.32
37 0.27
38 0.26
39 0.2
40 0.18
41 0.16
42 0.13
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.05
56 0.05
57 0.06
58 0.07
59 0.07
60 0.08
61 0.1
62 0.12
63 0.11
64 0.11
65 0.12
66 0.14
67 0.14
68 0.14
69 0.13
70 0.13
71 0.16
72 0.18
73 0.23
74 0.21
75 0.25
76 0.27
77 0.28
78 0.28
79 0.26
80 0.27
81 0.26
82 0.33
83 0.35
84 0.34
85 0.35
86 0.33
87 0.32
88 0.32
89 0.27
90 0.19
91 0.13
92 0.17
93 0.17
94 0.17
95 0.19
96 0.16
97 0.16
98 0.18
99 0.18
100 0.13
101 0.11
102 0.11
103 0.12
104 0.12
105 0.12
106 0.11
107 0.11
108 0.11
109 0.13
110 0.14
111 0.13
112 0.14