Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YDG1

Protein Details
Accession A0A2T9YDG1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
234-260NLYGNDKRKKSFRKKNTRLQDHNISPSHydrophilic
NLS Segment(s)
PositionSequence
240-248KRKKSFRKK
Subcellular Location(s) nucl 13.5, mito_nucl 12.5, mito 10.5
Family & Domain DBs
Amino Acid Sequences THAPNKTRNGSHINIRTSDLRERAYFKYPTLRTWISDLVKQPIRSQTSTWVTGTARWMKRYCQTVGRGNTVKALQHRYTVNDKTKISAWIKAHNMRNTGSWMDLQMRHPDIKLGLQDIGKIRMGCYWTAQRLAKAGLIPKMYIERCPFCNKNTPETIEHMLVECFRWNSIRHETTVFNIPRLYRTVTIDQSTNNQALNQGRNIMLDSFKMNPNSLEPIPVVYGVPGGWRGTGTNLYGNDKRKKSFRKKNTRLQDHNISPSINFLKGLIMVRSSMLSSGVGYLVIFDDGLNKFLDKRVLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.5
4 0.48
5 0.5
6 0.45
7 0.41
8 0.39
9 0.42
10 0.43
11 0.46
12 0.43
13 0.39
14 0.45
15 0.42
16 0.42
17 0.46
18 0.44
19 0.38
20 0.41
21 0.45
22 0.38
23 0.41
24 0.41
25 0.41
26 0.45
27 0.44
28 0.44
29 0.44
30 0.47
31 0.44
32 0.42
33 0.43
34 0.43
35 0.45
36 0.41
37 0.36
38 0.31
39 0.32
40 0.37
41 0.37
42 0.35
43 0.38
44 0.39
45 0.4
46 0.46
47 0.49
48 0.46
49 0.44
50 0.46
51 0.5
52 0.53
53 0.57
54 0.53
55 0.48
56 0.48
57 0.42
58 0.39
59 0.35
60 0.38
61 0.31
62 0.32
63 0.33
64 0.34
65 0.4
66 0.45
67 0.47
68 0.46
69 0.45
70 0.43
71 0.44
72 0.46
73 0.41
74 0.4
75 0.34
76 0.36
77 0.42
78 0.47
79 0.52
80 0.48
81 0.49
82 0.43
83 0.42
84 0.38
85 0.32
86 0.26
87 0.19
88 0.16
89 0.18
90 0.2
91 0.2
92 0.21
93 0.23
94 0.22
95 0.22
96 0.22
97 0.19
98 0.18
99 0.17
100 0.14
101 0.14
102 0.13
103 0.16
104 0.16
105 0.18
106 0.17
107 0.16
108 0.15
109 0.15
110 0.16
111 0.13
112 0.15
113 0.17
114 0.17
115 0.21
116 0.22
117 0.2
118 0.2
119 0.21
120 0.19
121 0.16
122 0.17
123 0.16
124 0.16
125 0.15
126 0.15
127 0.18
128 0.17
129 0.19
130 0.2
131 0.19
132 0.21
133 0.28
134 0.29
135 0.26
136 0.36
137 0.34
138 0.37
139 0.38
140 0.38
141 0.33
142 0.35
143 0.36
144 0.27
145 0.25
146 0.2
147 0.17
148 0.14
149 0.12
150 0.1
151 0.07
152 0.07
153 0.09
154 0.1
155 0.15
156 0.22
157 0.23
158 0.24
159 0.26
160 0.26
161 0.27
162 0.34
163 0.29
164 0.23
165 0.23
166 0.22
167 0.21
168 0.23
169 0.23
170 0.16
171 0.2
172 0.24
173 0.25
174 0.26
175 0.25
176 0.23
177 0.24
178 0.25
179 0.22
180 0.17
181 0.15
182 0.17
183 0.19
184 0.21
185 0.18
186 0.17
187 0.17
188 0.17
189 0.18
190 0.15
191 0.13
192 0.11
193 0.12
194 0.13
195 0.16
196 0.17
197 0.17
198 0.16
199 0.17
200 0.22
201 0.2
202 0.19
203 0.16
204 0.16
205 0.16
206 0.16
207 0.14
208 0.08
209 0.09
210 0.07
211 0.08
212 0.08
213 0.07
214 0.07
215 0.08
216 0.08
217 0.1
218 0.12
219 0.13
220 0.16
221 0.17
222 0.23
223 0.28
224 0.36
225 0.42
226 0.44
227 0.48
228 0.53
229 0.62
230 0.68
231 0.74
232 0.77
233 0.8
234 0.85
235 0.92
236 0.93
237 0.93
238 0.9
239 0.88
240 0.87
241 0.81
242 0.78
243 0.69
244 0.59
245 0.48
246 0.46
247 0.4
248 0.3
249 0.24
250 0.18
251 0.17
252 0.19
253 0.22
254 0.16
255 0.15
256 0.14
257 0.15
258 0.15
259 0.14
260 0.12
261 0.1
262 0.09
263 0.09
264 0.09
265 0.09
266 0.08
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.05
273 0.11
274 0.11
275 0.13
276 0.13
277 0.13
278 0.14
279 0.18