Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Z7Y6

Protein Details
Accession A0A2T9Z7Y6    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
110-130ESRNTKPKGAPEKKRRHNGAYBasic
134-153HVTSRCYKNQPKPKEKTNINHydrophilic
NLS Segment(s)
PositionSequence
115-125KPKGAPEKKRR
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
Amino Acid Sequences MKKDDEETLSDFCYRFERYCDTMPKGFLTPEIKKDSFIRILYGIDREIWGKVVTDIEKKSSKNLIEEAIKLAAINEKYGKGFQEDKPTKLTKDEKELGKYQTSLAKNSEESRNTKPKGAPEKKRRHNGAYQCSHVTSRCYKNQPKPKEKTNINSNHENGMDTQSSEKKESYLVLASEENSSETEDDLILTTTIPTKRIRVEDILNDKFDDEKNRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.24
4 0.28
5 0.31
6 0.39
7 0.45
8 0.47
9 0.48
10 0.48
11 0.46
12 0.42
13 0.37
14 0.35
15 0.35
16 0.34
17 0.37
18 0.43
19 0.4
20 0.41
21 0.43
22 0.44
23 0.42
24 0.38
25 0.34
26 0.27
27 0.28
28 0.27
29 0.27
30 0.21
31 0.15
32 0.15
33 0.14
34 0.13
35 0.13
36 0.11
37 0.1
38 0.1
39 0.13
40 0.15
41 0.19
42 0.2
43 0.23
44 0.28
45 0.27
46 0.31
47 0.33
48 0.33
49 0.3
50 0.31
51 0.31
52 0.29
53 0.29
54 0.27
55 0.21
56 0.19
57 0.16
58 0.15
59 0.14
60 0.11
61 0.12
62 0.11
63 0.12
64 0.13
65 0.14
66 0.14
67 0.13
68 0.18
69 0.2
70 0.3
71 0.31
72 0.32
73 0.37
74 0.38
75 0.36
76 0.38
77 0.41
78 0.33
79 0.39
80 0.43
81 0.4
82 0.43
83 0.46
84 0.42
85 0.36
86 0.34
87 0.27
88 0.28
89 0.26
90 0.23
91 0.21
92 0.2
93 0.2
94 0.22
95 0.26
96 0.22
97 0.25
98 0.3
99 0.37
100 0.37
101 0.39
102 0.39
103 0.42
104 0.5
105 0.56
106 0.59
107 0.62
108 0.72
109 0.76
110 0.84
111 0.81
112 0.75
113 0.74
114 0.73
115 0.72
116 0.67
117 0.61
118 0.53
119 0.49
120 0.45
121 0.37
122 0.32
123 0.3
124 0.31
125 0.35
126 0.42
127 0.49
128 0.58
129 0.68
130 0.74
131 0.77
132 0.78
133 0.79
134 0.8
135 0.78
136 0.77
137 0.77
138 0.77
139 0.72
140 0.72
141 0.64
142 0.58
143 0.52
144 0.44
145 0.34
146 0.28
147 0.23
148 0.17
149 0.19
150 0.2
151 0.22
152 0.23
153 0.22
154 0.19
155 0.2
156 0.2
157 0.19
158 0.19
159 0.16
160 0.17
161 0.18
162 0.18
163 0.18
164 0.17
165 0.15
166 0.12
167 0.13
168 0.1
169 0.1
170 0.09
171 0.08
172 0.08
173 0.08
174 0.08
175 0.07
176 0.07
177 0.07
178 0.12
179 0.13
180 0.16
181 0.18
182 0.21
183 0.27
184 0.31
185 0.35
186 0.35
187 0.4
188 0.47
189 0.55
190 0.55
191 0.51
192 0.47
193 0.43
194 0.4
195 0.37