Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9ZDY2

Protein Details
Accession A0A2T9ZDY2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-64LYTLCVKDKKRAEKLRQSFPPGLHydrophilic
NLS Segment(s)
PositionSequence
18-31KDAKSVKVKKSGDK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MAKQIQDIKNFLEVTRRKDAKSVKVKKSGDKIKFKVRCSRYLYTLCVKDKKRAEKLRQSFPPGLVVTDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.44
4 0.39
5 0.45
6 0.51
7 0.52
8 0.59
9 0.62
10 0.6
11 0.67
12 0.69
13 0.69
14 0.72
15 0.72
16 0.69
17 0.69
18 0.65
19 0.66
20 0.7
21 0.67
22 0.67
23 0.61
24 0.6
25 0.58
26 0.57
27 0.52
28 0.5
29 0.5
30 0.47
31 0.5
32 0.47
33 0.48
34 0.47
35 0.49
36 0.54
37 0.59
38 0.64
39 0.67
40 0.72
41 0.75
42 0.81
43 0.83
44 0.83
45 0.81
46 0.74
47 0.65
48 0.62
49 0.52