Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9ZFC2

Protein Details
Accession A0A2T9ZFC2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
208-233FKQALFEQKKHERRRQFNKDPASSKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
Amino Acid Sequences MGIHMVIKYWHKDLTIIIYFHIVLPELEKISEEDYYRLNVPFCKWLLKEKGKYFEEIDSSRARKYFFRFVKEWNKNRLDEKYYRFTDDPSTLKEEFTFTNHKWNFKKNDSEEHKDIKHRSVSSSFVSRNDKSEGHFREKTIKELKLEGKLKNRKQNERLEEALEQFASKETGRRAEILEKRARNRFYHADKDYDINIPEAELYEESSFKQALFEQKKHERRRQFNKDPASSKNADPSKIKAYMDKENDTIEMLRQLAYQNQRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.27
4 0.25
5 0.25
6 0.25
7 0.24
8 0.23
9 0.15
10 0.09
11 0.11
12 0.13
13 0.12
14 0.12
15 0.12
16 0.13
17 0.14
18 0.17
19 0.16
20 0.15
21 0.15
22 0.18
23 0.2
24 0.2
25 0.2
26 0.2
27 0.21
28 0.25
29 0.25
30 0.29
31 0.28
32 0.35
33 0.44
34 0.51
35 0.57
36 0.58
37 0.66
38 0.61
39 0.63
40 0.57
41 0.5
42 0.46
43 0.39
44 0.35
45 0.33
46 0.33
47 0.33
48 0.32
49 0.3
50 0.29
51 0.34
52 0.41
53 0.39
54 0.45
55 0.45
56 0.52
57 0.61
58 0.67
59 0.68
60 0.67
61 0.66
62 0.63
63 0.65
64 0.63
65 0.58
66 0.55
67 0.54
68 0.53
69 0.5
70 0.51
71 0.47
72 0.42
73 0.4
74 0.38
75 0.34
76 0.28
77 0.32
78 0.27
79 0.27
80 0.26
81 0.23
82 0.19
83 0.2
84 0.23
85 0.18
86 0.28
87 0.3
88 0.36
89 0.38
90 0.45
91 0.48
92 0.47
93 0.56
94 0.49
95 0.57
96 0.58
97 0.62
98 0.59
99 0.57
100 0.54
101 0.51
102 0.5
103 0.44
104 0.42
105 0.35
106 0.33
107 0.3
108 0.3
109 0.27
110 0.3
111 0.27
112 0.26
113 0.31
114 0.28
115 0.29
116 0.29
117 0.27
118 0.24
119 0.31
120 0.31
121 0.33
122 0.34
123 0.32
124 0.38
125 0.39
126 0.43
127 0.41
128 0.39
129 0.33
130 0.37
131 0.39
132 0.38
133 0.42
134 0.4
135 0.44
136 0.51
137 0.57
138 0.6
139 0.65
140 0.65
141 0.68
142 0.73
143 0.69
144 0.65
145 0.6
146 0.54
147 0.48
148 0.41
149 0.34
150 0.24
151 0.18
152 0.13
153 0.11
154 0.1
155 0.09
156 0.1
157 0.11
158 0.15
159 0.16
160 0.17
161 0.19
162 0.27
163 0.32
164 0.36
165 0.43
166 0.44
167 0.48
168 0.55
169 0.56
170 0.49
171 0.51
172 0.52
173 0.51
174 0.55
175 0.53
176 0.5
177 0.47
178 0.47
179 0.43
180 0.36
181 0.3
182 0.21
183 0.18
184 0.14
185 0.13
186 0.11
187 0.11
188 0.08
189 0.09
190 0.09
191 0.1
192 0.1
193 0.12
194 0.12
195 0.1
196 0.11
197 0.12
198 0.22
199 0.29
200 0.32
201 0.39
202 0.5
203 0.6
204 0.68
205 0.75
206 0.75
207 0.78
208 0.86
209 0.88
210 0.88
211 0.88
212 0.88
213 0.88
214 0.82
215 0.77
216 0.73
217 0.65
218 0.57
219 0.57
220 0.51
221 0.46
222 0.44
223 0.44
224 0.43
225 0.44
226 0.44
227 0.4
228 0.42
229 0.47
230 0.51
231 0.5
232 0.45
233 0.42
234 0.41
235 0.37
236 0.33
237 0.25
238 0.22
239 0.18
240 0.17
241 0.16
242 0.17
243 0.22