Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9ZH76

Protein Details
Accession A0A2T9ZH76   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23METSKFTIRKKNISRNPQTTQQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR006671  Cyclin_N  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF00134  Cyclin_N  
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences METSKFTIRKKNISRNPQTTQQTLDRNLLIDLIVHLVSSNLCLHQDDFSRFPSSNLNSPHSLSDQSYNSESSYSTVASETKYYVERLANGLSLPDPVLLHSLVYIYRLMRRLPASFVAQDSAKYKIFVTSIVIATKYCQDDQFITCKAAVALFNGAFSVSEIIKMEIAFLKILKYQLSLNRKETSKIIMYYSQSINFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.84
4 0.82
5 0.78
6 0.69
7 0.65
8 0.61
9 0.58
10 0.53
11 0.5
12 0.41
13 0.37
14 0.34
15 0.28
16 0.21
17 0.14
18 0.11
19 0.09
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.07
28 0.08
29 0.09
30 0.1
31 0.13
32 0.17
33 0.19
34 0.2
35 0.22
36 0.25
37 0.24
38 0.24
39 0.28
40 0.27
41 0.3
42 0.32
43 0.34
44 0.32
45 0.33
46 0.34
47 0.29
48 0.27
49 0.22
50 0.22
51 0.2
52 0.2
53 0.21
54 0.19
55 0.18
56 0.17
57 0.15
58 0.12
59 0.11
60 0.09
61 0.08
62 0.08
63 0.09
64 0.09
65 0.1
66 0.09
67 0.09
68 0.1
69 0.11
70 0.12
71 0.12
72 0.12
73 0.13
74 0.13
75 0.12
76 0.11
77 0.1
78 0.08
79 0.08
80 0.07
81 0.06
82 0.05
83 0.05
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.08
94 0.1
95 0.1
96 0.13
97 0.15
98 0.16
99 0.17
100 0.19
101 0.19
102 0.18
103 0.18
104 0.17
105 0.15
106 0.15
107 0.14
108 0.15
109 0.13
110 0.13
111 0.13
112 0.13
113 0.13
114 0.13
115 0.14
116 0.13
117 0.14
118 0.14
119 0.15
120 0.13
121 0.13
122 0.17
123 0.16
124 0.14
125 0.14
126 0.15
127 0.17
128 0.19
129 0.23
130 0.21
131 0.2
132 0.19
133 0.19
134 0.17
135 0.16
136 0.14
137 0.11
138 0.13
139 0.11
140 0.11
141 0.11
142 0.11
143 0.09
144 0.09
145 0.1
146 0.06
147 0.08
148 0.09
149 0.09
150 0.1
151 0.1
152 0.11
153 0.11
154 0.12
155 0.12
156 0.11
157 0.12
158 0.14
159 0.15
160 0.15
161 0.14
162 0.18
163 0.26
164 0.35
165 0.39
166 0.42
167 0.47
168 0.48
169 0.49
170 0.47
171 0.45
172 0.42
173 0.38
174 0.37
175 0.36
176 0.38
177 0.41
178 0.42