Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9ZJK6

Protein Details
Accession A0A2T9ZJK6   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
158-191LEEVVPKKKSKPVPPSKRKKYTRQSSYNKRPKRRBasic
NLS Segment(s)
PositionSequence
163-191PKKKSKPVPPSKRKKYTRQSSYNKRPKRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012423  Eaf7/MRGBP  
Gene Ontology GO:0043189  C:H4/H2A histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07904  Eaf7  
Amino Acid Sequences MSNLNWDTHLDLCLLQAMSGLRPVEKVPHLDISAQDLWSRLREWYDLEVLEELENDSDSELQNYPEDKQKEQERENIKPRHIYTIERPDDPYFWKQEAEFCLPWDEYGVLILERAGEGVEEVFSPSADGLSQDQLSSKYSTPESTFEEIEEEPAKPVLEEVVPKKKSKPVPPSKRKKYTRQSSYNKRPKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.12
4 0.12
5 0.12
6 0.15
7 0.15
8 0.12
9 0.13
10 0.14
11 0.18
12 0.2
13 0.23
14 0.22
15 0.26
16 0.27
17 0.27
18 0.27
19 0.28
20 0.27
21 0.24
22 0.22
23 0.18
24 0.18
25 0.19
26 0.19
27 0.14
28 0.13
29 0.14
30 0.16
31 0.18
32 0.2
33 0.18
34 0.18
35 0.17
36 0.16
37 0.15
38 0.12
39 0.09
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.08
48 0.09
49 0.1
50 0.11
51 0.12
52 0.19
53 0.21
54 0.2
55 0.26
56 0.32
57 0.38
58 0.39
59 0.46
60 0.45
61 0.51
62 0.59
63 0.58
64 0.53
65 0.52
66 0.5
67 0.5
68 0.45
69 0.4
70 0.38
71 0.44
72 0.44
73 0.39
74 0.4
75 0.34
76 0.33
77 0.34
78 0.29
79 0.21
80 0.19
81 0.19
82 0.17
83 0.19
84 0.22
85 0.23
86 0.2
87 0.18
88 0.2
89 0.19
90 0.19
91 0.16
92 0.12
93 0.07
94 0.07
95 0.07
96 0.05
97 0.05
98 0.05
99 0.04
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.06
117 0.08
118 0.08
119 0.08
120 0.09
121 0.1
122 0.13
123 0.14
124 0.13
125 0.14
126 0.15
127 0.18
128 0.19
129 0.21
130 0.24
131 0.25
132 0.24
133 0.22
134 0.24
135 0.21
136 0.22
137 0.2
138 0.15
139 0.13
140 0.14
141 0.14
142 0.11
143 0.11
144 0.1
145 0.1
146 0.15
147 0.21
148 0.3
149 0.33
150 0.35
151 0.39
152 0.45
153 0.52
154 0.57
155 0.62
156 0.63
157 0.72
158 0.81
159 0.89
160 0.92
161 0.94
162 0.93
163 0.92
164 0.92
165 0.92
166 0.91
167 0.91
168 0.91
169 0.92
170 0.94
171 0.94