Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Z8A9

Protein Details
Accession A0A2T9Z8A9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-107KEWIIKKILKPERKKPPRKTSTRVNNSFFHydrophilic
NLS Segment(s)
PositionSequence
84-97KKILKPERKKPPRK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MNNYNNLFQTSNLDSSSRTTELASSPSNDTSLGVSKEFTGQVSTVKDIIPREYIDNNGSTFLEKVPGHYAVFIPQSIPKEWIIKKILKPERKKPPRKTSTRVNNSFFLYRKDVNRVITKLHPKLNQKEISKIIAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.27
4 0.22
5 0.19
6 0.17
7 0.18
8 0.19
9 0.22
10 0.21
11 0.18
12 0.2
13 0.2
14 0.2
15 0.18
16 0.17
17 0.15
18 0.18
19 0.16
20 0.14
21 0.14
22 0.14
23 0.16
24 0.15
25 0.14
26 0.11
27 0.1
28 0.12
29 0.13
30 0.14
31 0.13
32 0.13
33 0.15
34 0.14
35 0.16
36 0.15
37 0.14
38 0.16
39 0.16
40 0.18
41 0.17
42 0.17
43 0.15
44 0.14
45 0.13
46 0.11
47 0.11
48 0.09
49 0.12
50 0.11
51 0.12
52 0.13
53 0.14
54 0.14
55 0.14
56 0.14
57 0.11
58 0.12
59 0.11
60 0.09
61 0.1
62 0.12
63 0.13
64 0.15
65 0.14
66 0.2
67 0.21
68 0.26
69 0.28
70 0.31
71 0.34
72 0.43
73 0.5
74 0.53
75 0.59
76 0.63
77 0.7
78 0.76
79 0.83
80 0.84
81 0.86
82 0.88
83 0.89
84 0.86
85 0.86
86 0.86
87 0.86
88 0.83
89 0.76
90 0.69
91 0.64
92 0.62
93 0.53
94 0.47
95 0.42
96 0.38
97 0.38
98 0.41
99 0.42
100 0.43
101 0.48
102 0.45
103 0.44
104 0.49
105 0.55
106 0.54
107 0.58
108 0.59
109 0.61
110 0.67
111 0.72
112 0.72
113 0.65
114 0.67
115 0.63