Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9ZI92

Protein Details
Accession A0A2T9ZI92    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-122STSELNKKTLRQKKRITHFSVKKYAIKHydrophilic
NLS Segment(s)
PositionSequence
72-111LASKGKRIPLDLRFKKTRAMRRALSTSELNKKTLRQKKRI
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MTAKVNVAELREKSKAELLQTVSQMKKQIIGLRHQHASGGSGSQGVKIRELRKNIARVLTVITQEERKKVLLASKGKRIPLDLRFKKTRAMRRALSTSELNKKTLRQKKRITHFSVKKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.3
4 0.33
5 0.32
6 0.34
7 0.37
8 0.41
9 0.36
10 0.36
11 0.36
12 0.31
13 0.29
14 0.27
15 0.29
16 0.27
17 0.34
18 0.38
19 0.4
20 0.42
21 0.39
22 0.36
23 0.31
24 0.29
25 0.22
26 0.15
27 0.1
28 0.1
29 0.1
30 0.13
31 0.16
32 0.14
33 0.17
34 0.21
35 0.26
36 0.29
37 0.33
38 0.35
39 0.37
40 0.41
41 0.4
42 0.38
43 0.32
44 0.28
45 0.27
46 0.24
47 0.19
48 0.15
49 0.14
50 0.16
51 0.17
52 0.18
53 0.16
54 0.14
55 0.14
56 0.15
57 0.19
58 0.22
59 0.3
60 0.33
61 0.4
62 0.43
63 0.44
64 0.44
65 0.42
66 0.4
67 0.4
68 0.47
69 0.45
70 0.5
71 0.53
72 0.54
73 0.58
74 0.6
75 0.62
76 0.59
77 0.59
78 0.56
79 0.59
80 0.63
81 0.58
82 0.54
83 0.5
84 0.49
85 0.51
86 0.48
87 0.43
88 0.4
89 0.44
90 0.5
91 0.55
92 0.58
93 0.58
94 0.67
95 0.74
96 0.83
97 0.87
98 0.86
99 0.87
100 0.87
101 0.86
102 0.86
103 0.81