Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9ZAE7

Protein Details
Accession A0A2T9ZAE7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-129GIGEAQKTSRKQRKERKNRLKKLRGTAKVKGLKKBasic
NLS Segment(s)
PositionSequence
98-133GEAQKTSRKQRKERKNRLKKLRGTAKVKGLKKKKEE
Subcellular Location(s) mito 19.5, cyto_mito 11.833, nucl 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MAEGTVTLRTRKFVTNRLLSRKQMILDVIHPGLAGVSKDNIREKLAAMFKTSKDFVYVFGFKLLFGGGKSTGFALIYDSLDAAKRFEPKYRLLRHGIGEAQKTSRKQRKERKNRLKKLRGTAKVKGLKKKKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.6
4 0.67
5 0.71
6 0.66
7 0.65
8 0.6
9 0.52
10 0.44
11 0.38
12 0.31
13 0.25
14 0.27
15 0.22
16 0.18
17 0.17
18 0.14
19 0.12
20 0.11
21 0.09
22 0.06
23 0.08
24 0.09
25 0.12
26 0.16
27 0.17
28 0.18
29 0.18
30 0.18
31 0.23
32 0.26
33 0.24
34 0.24
35 0.26
36 0.25
37 0.28
38 0.28
39 0.21
40 0.19
41 0.18
42 0.17
43 0.19
44 0.2
45 0.16
46 0.17
47 0.17
48 0.15
49 0.15
50 0.13
51 0.07
52 0.06
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.06
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.09
71 0.14
72 0.15
73 0.2
74 0.23
75 0.29
76 0.39
77 0.44
78 0.47
79 0.48
80 0.5
81 0.47
82 0.47
83 0.45
84 0.39
85 0.36
86 0.32
87 0.32
88 0.33
89 0.34
90 0.41
91 0.45
92 0.5
93 0.58
94 0.67
95 0.74
96 0.81
97 0.89
98 0.9
99 0.93
100 0.95
101 0.96
102 0.95
103 0.93
104 0.92
105 0.92
106 0.9
107 0.86
108 0.83
109 0.82
110 0.81
111 0.79
112 0.79
113 0.78