Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9ZGU6

Protein Details
Accession A0A2T9ZGU6    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-46DMKQILKANKGNKKKFKKRKIEEYDGLQHydrophilic
NLS Segment(s)
PositionSequence
25-38KANKGNKKKFKKRK
89-96RRKKYSRK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039754  Esf1  
IPR012580  NUC153  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF08159  NUC153  
Amino Acid Sequences MDDPTNKEINQTSNSGHFDMKQILKANKGNKKKFKKRKIEEYDGLQESFTMDAQDDRFASVYTSSDFAIDPNSKNFKKTKAMENLLNERRKKYSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.29
4 0.25
5 0.25
6 0.28
7 0.27
8 0.26
9 0.3
10 0.29
11 0.35
12 0.39
13 0.45
14 0.48
15 0.57
16 0.62
17 0.66
18 0.75
19 0.81
20 0.87
21 0.88
22 0.9
23 0.89
24 0.91
25 0.9
26 0.88
27 0.81
28 0.76
29 0.72
30 0.62
31 0.53
32 0.41
33 0.31
34 0.23
35 0.18
36 0.12
37 0.06
38 0.04
39 0.05
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.07
48 0.08
49 0.08
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.12
56 0.14
57 0.15
58 0.2
59 0.28
60 0.28
61 0.32
62 0.35
63 0.37
64 0.44
65 0.47
66 0.51
67 0.53
68 0.59
69 0.62
70 0.67
71 0.71
72 0.7
73 0.73
74 0.66
75 0.6
76 0.62