Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Z434

Protein Details
Accession A0A2T9Z434    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MNTSKRSHPRSVNKSPSIKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037119  Haem_oxidase_HugZ-like_sf  
Amino Acid Sequences MNTSKRSHPRSVNKSPSIKGLDLLMNELNTKHADCLKLIAVNTGENSSVVKSYISDLDNSSFTLCWEYSDSSPNEEMIFTFKKSLSTKTEIMSHISELVDSAITDLKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.74
3 0.71
4 0.65
5 0.56
6 0.46
7 0.38
8 0.33
9 0.27
10 0.28
11 0.21
12 0.16
13 0.16
14 0.15
15 0.14
16 0.12
17 0.12
18 0.11
19 0.13
20 0.13
21 0.13
22 0.15
23 0.15
24 0.16
25 0.16
26 0.16
27 0.14
28 0.13
29 0.14
30 0.12
31 0.11
32 0.08
33 0.09
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.06
40 0.09
41 0.09
42 0.1
43 0.1
44 0.11
45 0.12
46 0.12
47 0.11
48 0.08
49 0.08
50 0.09
51 0.08
52 0.08
53 0.1
54 0.12
55 0.12
56 0.17
57 0.18
58 0.19
59 0.19
60 0.18
61 0.17
62 0.14
63 0.14
64 0.14
65 0.15
66 0.13
67 0.15
68 0.15
69 0.21
70 0.23
71 0.28
72 0.29
73 0.33
74 0.34
75 0.35
76 0.39
77 0.35
78 0.37
79 0.33
80 0.28
81 0.24
82 0.22
83 0.19
84 0.14
85 0.14
86 0.1
87 0.08
88 0.09