Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9XYD7

Protein Details
Accession A0A2T9XYD7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-73RDITNKLSFKKKKRNGTAKALQHHydrophilic
NLS Segment(s)
PositionSequence
60-64KKKKR
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences SLLAQSRDRYSPYMKELETGRFMNGIRVVRTLILDRIKCSPTPLNQCPVDRDITNKLSFKKKKRNGTAKALQHRYTVNDKTKISAWIKAHNMRNTGSWMDLQMCHPDNKLGLQDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.38
4 0.38
5 0.38
6 0.33
7 0.28
8 0.25
9 0.25
10 0.25
11 0.27
12 0.25
13 0.21
14 0.21
15 0.21
16 0.19
17 0.2
18 0.18
19 0.18
20 0.22
21 0.21
22 0.22
23 0.26
24 0.27
25 0.26
26 0.28
27 0.28
28 0.29
29 0.37
30 0.39
31 0.41
32 0.42
33 0.43
34 0.42
35 0.39
36 0.34
37 0.25
38 0.25
39 0.24
40 0.25
41 0.27
42 0.27
43 0.28
44 0.35
45 0.42
46 0.48
47 0.54
48 0.58
49 0.66
50 0.74
51 0.81
52 0.78
53 0.81
54 0.8
55 0.78
56 0.8
57 0.75
58 0.66
59 0.58
60 0.52
61 0.47
62 0.45
63 0.43
64 0.41
65 0.41
66 0.4
67 0.4
68 0.41
69 0.44
70 0.39
71 0.38
72 0.34
73 0.36
74 0.42
75 0.48
76 0.54
77 0.51
78 0.52
79 0.46
80 0.46
81 0.42
82 0.36
83 0.3
84 0.23
85 0.2
86 0.2
87 0.2
88 0.2
89 0.23
90 0.24
91 0.24
92 0.24
93 0.25
94 0.24
95 0.25