Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9XZC1

Protein Details
Accession A0A2T9XZC1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
33-52VLACKKCKKVFRKDPAAQETHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 11, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences VSVRAPCCKKWFDCPECHNETSDHPLKKANEIVLACKKCKKVFRKDPAAQETDESDEYCPFCDNHYVIEAKIPQMALGVDGGDIRLDNRIAKDFRTKNAAKKSIFNPSDLDHRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.69
4 0.66
5 0.57
6 0.48
7 0.44
8 0.44
9 0.45
10 0.38
11 0.32
12 0.37
13 0.37
14 0.4
15 0.4
16 0.32
17 0.3
18 0.29
19 0.35
20 0.38
21 0.4
22 0.38
23 0.39
24 0.42
25 0.41
26 0.49
27 0.52
28 0.54
29 0.61
30 0.69
31 0.75
32 0.77
33 0.8
34 0.77
35 0.7
36 0.59
37 0.49
38 0.4
39 0.32
40 0.26
41 0.18
42 0.13
43 0.11
44 0.11
45 0.1
46 0.1
47 0.08
48 0.08
49 0.1
50 0.1
51 0.1
52 0.12
53 0.12
54 0.12
55 0.15
56 0.15
57 0.12
58 0.13
59 0.12
60 0.09
61 0.09
62 0.09
63 0.06
64 0.06
65 0.05
66 0.04
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.06
73 0.06
74 0.08
75 0.1
76 0.16
77 0.17
78 0.2
79 0.3
80 0.32
81 0.35
82 0.42
83 0.44
84 0.48
85 0.57
86 0.62
87 0.55
88 0.59
89 0.6
90 0.62
91 0.59
92 0.52
93 0.45
94 0.4
95 0.47