Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9XYY0

Protein Details
Accession A0A2T9XYY0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
156-179RCTSNDCDKKKRYKECINENGKGDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.333, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008037  Pacifastin_dom  
IPR036201  Pacifastin_dom_sf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030414  F:peptidase inhibitor activity  
Pfam View protein in Pfam  
PF05375  Pacifastin_I  
Amino Acid Sequences YGSGDFKSPNDSCNTCKCNEKGDLDCTKNDCNRANKYDECVNDNGAGEFKLPNDDCNTCVCLKNGEVGCTQKVCDPIDPYRTCTEQYGEDSFKSPYDKCNTCRCNKKGELNCTNKSCSGGNGYAKCIRKYGKGNFKSPHENDGCNTCKCLSSGGLRCTSNDCDKKKRYKECINENGKGDFKSPRDDCNTCKCLSNGDLACSNEDCNNNSSYES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.48
4 0.46
5 0.47
6 0.5
7 0.51
8 0.47
9 0.51
10 0.57
11 0.52
12 0.54
13 0.51
14 0.52
15 0.5
16 0.51
17 0.49
18 0.48
19 0.53
20 0.54
21 0.56
22 0.52
23 0.53
24 0.53
25 0.49
26 0.46
27 0.39
28 0.36
29 0.31
30 0.29
31 0.24
32 0.19
33 0.16
34 0.13
35 0.11
36 0.1
37 0.15
38 0.14
39 0.16
40 0.19
41 0.2
42 0.2
43 0.22
44 0.25
45 0.2
46 0.21
47 0.2
48 0.18
49 0.18
50 0.24
51 0.22
52 0.21
53 0.22
54 0.23
55 0.24
56 0.22
57 0.22
58 0.18
59 0.2
60 0.19
61 0.19
62 0.21
63 0.24
64 0.32
65 0.32
66 0.33
67 0.33
68 0.33
69 0.31
70 0.28
71 0.26
72 0.19
73 0.22
74 0.22
75 0.21
76 0.2
77 0.2
78 0.19
79 0.19
80 0.19
81 0.16
82 0.17
83 0.22
84 0.26
85 0.29
86 0.38
87 0.43
88 0.47
89 0.57
90 0.54
91 0.56
92 0.56
93 0.62
94 0.59
95 0.63
96 0.66
97 0.63
98 0.66
99 0.6
100 0.57
101 0.48
102 0.42
103 0.33
104 0.25
105 0.21
106 0.2
107 0.22
108 0.22
109 0.25
110 0.29
111 0.31
112 0.31
113 0.3
114 0.28
115 0.29
116 0.36
117 0.42
118 0.47
119 0.49
120 0.56
121 0.57
122 0.61
123 0.64
124 0.58
125 0.57
126 0.49
127 0.45
128 0.39
129 0.42
130 0.41
131 0.32
132 0.32
133 0.24
134 0.22
135 0.21
136 0.22
137 0.17
138 0.22
139 0.28
140 0.31
141 0.35
142 0.34
143 0.35
144 0.37
145 0.39
146 0.4
147 0.41
148 0.43
149 0.48
150 0.56
151 0.66
152 0.71
153 0.77
154 0.78
155 0.8
156 0.84
157 0.85
158 0.87
159 0.85
160 0.8
161 0.73
162 0.68
163 0.6
164 0.51
165 0.43
166 0.39
167 0.33
168 0.37
169 0.36
170 0.38
171 0.43
172 0.46
173 0.49
174 0.53
175 0.55
176 0.46
177 0.48
178 0.42
179 0.39
180 0.38
181 0.41
182 0.33
183 0.33
184 0.37
185 0.34
186 0.36
187 0.32
188 0.32
189 0.27
190 0.28
191 0.26
192 0.24
193 0.25