Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9ZL07

Protein Details
Accession A0A2T9ZL07   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MLRSEQKKNKKRKSKIPSTNLSFEQHydrophilic
NLS Segment(s)
PositionSequence
7-15KKNKKRKSK
Subcellular Location(s) nucl 18.5, mito_nucl 13.166, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007005  XAP5  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04921  XAP5  
Amino Acid Sequences MLRSEQKKNKKRKSKIPSTNLSFEQEDSLPELDDSEKLNKKQALKKDPYVNTSFLPDKQRDELIAEKREIFRSEWLQEQERIKNEEITVAFSYWDGSGHRYSVSCKKGDSISTFLEKSKLVAHQIRGANVENLMFIKEDLIIPHHYTFYDFIVNKVRGKSGPLFNFTAYEDIRLVNDATVEKQDSHVGKICERHWYERNKHIFPANRWELYNPELTYGPYTIKDKPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.92
4 0.92
5 0.88
6 0.85
7 0.77
8 0.7
9 0.6
10 0.5
11 0.43
12 0.33
13 0.26
14 0.22
15 0.2
16 0.15
17 0.14
18 0.14
19 0.12
20 0.13
21 0.14
22 0.2
23 0.25
24 0.26
25 0.33
26 0.36
27 0.44
28 0.5
29 0.57
30 0.59
31 0.6
32 0.67
33 0.7
34 0.71
35 0.69
36 0.65
37 0.57
38 0.48
39 0.45
40 0.39
41 0.34
42 0.35
43 0.32
44 0.32
45 0.32
46 0.32
47 0.28
48 0.29
49 0.32
50 0.33
51 0.35
52 0.32
53 0.32
54 0.33
55 0.35
56 0.33
57 0.28
58 0.25
59 0.26
60 0.27
61 0.3
62 0.31
63 0.31
64 0.34
65 0.37
66 0.37
67 0.35
68 0.37
69 0.32
70 0.31
71 0.28
72 0.28
73 0.24
74 0.23
75 0.2
76 0.16
77 0.15
78 0.13
79 0.14
80 0.1
81 0.1
82 0.07
83 0.08
84 0.09
85 0.09
86 0.1
87 0.1
88 0.13
89 0.2
90 0.23
91 0.21
92 0.21
93 0.22
94 0.23
95 0.26
96 0.25
97 0.21
98 0.2
99 0.22
100 0.22
101 0.2
102 0.2
103 0.17
104 0.15
105 0.14
106 0.13
107 0.15
108 0.17
109 0.18
110 0.24
111 0.25
112 0.25
113 0.25
114 0.25
115 0.21
116 0.18
117 0.17
118 0.1
119 0.09
120 0.09
121 0.07
122 0.05
123 0.05
124 0.05
125 0.06
126 0.06
127 0.08
128 0.09
129 0.11
130 0.12
131 0.12
132 0.12
133 0.13
134 0.13
135 0.12
136 0.17
137 0.15
138 0.16
139 0.24
140 0.26
141 0.27
142 0.27
143 0.27
144 0.22
145 0.26
146 0.3
147 0.3
148 0.33
149 0.34
150 0.35
151 0.34
152 0.34
153 0.31
154 0.29
155 0.21
156 0.18
157 0.15
158 0.13
159 0.13
160 0.13
161 0.13
162 0.09
163 0.1
164 0.09
165 0.1
166 0.12
167 0.13
168 0.13
169 0.13
170 0.19
171 0.19
172 0.22
173 0.26
174 0.25
175 0.27
176 0.32
177 0.32
178 0.36
179 0.39
180 0.43
181 0.45
182 0.53
183 0.57
184 0.61
185 0.68
186 0.62
187 0.62
188 0.63
189 0.64
190 0.59
191 0.63
192 0.61
193 0.55
194 0.53
195 0.51
196 0.47
197 0.41
198 0.43
199 0.33
200 0.28
201 0.26
202 0.26
203 0.26
204 0.24
205 0.23
206 0.2
207 0.23
208 0.27