Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9ZI76

Protein Details
Accession A0A2T9ZI76   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MWYSKNKKKPNKAQDKDPGPPVHydrophilic
147-169AEIVKVKIRKHRQNENKLLKSNSHydrophilic
NLS Segment(s)
PositionSequence
141-158KELKRLAEIVKVKIRKHR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, cyto 6, cyto_mito 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002661  Ribosome_recyc_fac  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Gene Ontology GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MWYSKNKKKPNKAQDKDPGPPVDIDNLVDLAALEEKMDREIESLFSSLASFNVGRANPSILSKISVSLSNSHDKVFLNKLADITIKDAQTLLVIPFEDESLKDIERAIRNVDLGLNPVKENNILKVLIPRQSNEAREKASKELKRLAEIVKVKIRKHRQNENKLLKSNSKANVPKDDVKFWEEQAVADHFISKVSSAVDAKLTELEKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.82
4 0.78
5 0.7
6 0.6
7 0.55
8 0.46
9 0.39
10 0.32
11 0.26
12 0.2
13 0.17
14 0.15
15 0.13
16 0.11
17 0.08
18 0.08
19 0.07
20 0.06
21 0.06
22 0.07
23 0.08
24 0.09
25 0.08
26 0.08
27 0.09
28 0.11
29 0.11
30 0.11
31 0.1
32 0.1
33 0.1
34 0.09
35 0.08
36 0.09
37 0.07
38 0.08
39 0.12
40 0.12
41 0.13
42 0.14
43 0.16
44 0.14
45 0.16
46 0.17
47 0.13
48 0.15
49 0.14
50 0.14
51 0.13
52 0.15
53 0.15
54 0.17
55 0.2
56 0.23
57 0.24
58 0.22
59 0.23
60 0.21
61 0.23
62 0.23
63 0.22
64 0.19
65 0.19
66 0.19
67 0.18
68 0.19
69 0.16
70 0.17
71 0.17
72 0.15
73 0.14
74 0.14
75 0.12
76 0.12
77 0.12
78 0.08
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.05
86 0.06
87 0.07
88 0.07
89 0.07
90 0.07
91 0.11
92 0.13
93 0.14
94 0.14
95 0.13
96 0.13
97 0.13
98 0.14
99 0.1
100 0.1
101 0.11
102 0.1
103 0.1
104 0.1
105 0.1
106 0.11
107 0.12
108 0.11
109 0.12
110 0.11
111 0.11
112 0.16
113 0.19
114 0.22
115 0.22
116 0.21
117 0.24
118 0.28
119 0.32
120 0.32
121 0.32
122 0.31
123 0.33
124 0.35
125 0.36
126 0.41
127 0.4
128 0.4
129 0.44
130 0.43
131 0.42
132 0.43
133 0.39
134 0.37
135 0.38
136 0.39
137 0.39
138 0.42
139 0.42
140 0.49
141 0.57
142 0.58
143 0.64
144 0.69
145 0.72
146 0.78
147 0.87
148 0.88
149 0.85
150 0.81
151 0.78
152 0.73
153 0.67
154 0.64
155 0.57
156 0.55
157 0.54
158 0.53
159 0.56
160 0.57
161 0.59
162 0.56
163 0.56
164 0.5
165 0.48
166 0.45
167 0.37
168 0.38
169 0.3
170 0.26
171 0.25
172 0.24
173 0.22
174 0.2
175 0.21
176 0.14
177 0.15
178 0.15
179 0.12
180 0.1
181 0.09
182 0.13
183 0.13
184 0.14
185 0.17
186 0.17
187 0.17
188 0.21