Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9ZHD8

Protein Details
Accession A0A2T9ZHD8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-76QPSQIKRKRKHGFFARLRTEGGRKILKRRRLKGRKYLSHBasic
NLS Segment(s)
PositionSequence
43-72KRKRKHGFFARLRTEGGRKILKRRRLKGRK
Subcellular Location(s) mito 13, nucl 9, cyto_nucl 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MCLLVLNSQLENSRILSQVQVGFPMMQVRWRTYGNEYQPSQIKRKRKHGFFARLRTEGGRKILKRRRLKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.17
5 0.19
6 0.18
7 0.16
8 0.15
9 0.13
10 0.13
11 0.15
12 0.12
13 0.13
14 0.15
15 0.16
16 0.18
17 0.19
18 0.2
19 0.22
20 0.29
21 0.29
22 0.34
23 0.33
24 0.33
25 0.37
26 0.38
27 0.42
28 0.41
29 0.45
30 0.46
31 0.57
32 0.63
33 0.63
34 0.71
35 0.73
36 0.78
37 0.78
38 0.81
39 0.76
40 0.69
41 0.65
42 0.58
43 0.52
44 0.46
45 0.43
46 0.42
47 0.39
48 0.48
49 0.56
50 0.62
51 0.68
52 0.74
53 0.79
54 0.81
55 0.87
56 0.87