Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9ZFU2

Protein Details
Accession A0A2T9ZFU2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-46VEKTDKPKKKTGRALKRIKYNRRFVTBasic
NLS Segment(s)
PositionSequence
13-43KVRSQAPKVEKTDKPKKKTGRALKRIKYNRR
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLTRAGKVRSQAPKVEKTDKPKKKTGRALKRIKYNRRFVTAAAFPGAKVRMNPAPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.44
4 0.45
5 0.48
6 0.55
7 0.57
8 0.61
9 0.57
10 0.58
11 0.65
12 0.67
13 0.67
14 0.68
15 0.7
16 0.71
17 0.77
18 0.78
19 0.78
20 0.79
21 0.84
22 0.82
23 0.84
24 0.85
25 0.85
26 0.83
27 0.82
28 0.77
29 0.73
30 0.67
31 0.57
32 0.55
33 0.47
34 0.4
35 0.33
36 0.28
37 0.21
38 0.24
39 0.25
40 0.19
41 0.16
42 0.2
43 0.23