Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YJE1

Protein Details
Accession A0A2T9YJE1   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-26QAAFKTKKAPVKKTDKNSDTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.833, cyto 5.5, cyto_mito 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR038718  SNF2-like_sf  
IPR000330  SNF2_N  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140658  F:ATP-dependent chromatin remodeler activity  
Pfam View protein in Pfam  
PF00176  SNF2-rel_dom  
Amino Acid Sequences SFDSIQAAFKTKKAPVKKTDKNSDTEDQQNDAEPKVSVPNSLSPIELSHIKKAQMLLAPFVLRRRKADVMKELPKKIESVLKLPLTDTQSKKYNQLLEAHKKILEKSHQKDLSTTNLQLLAYPNEAISQNKESIKSWIGRMMELRKVANHPVLVRSFYTEEKLKKMASLILLIALFIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.67
4 0.75
5 0.79
6 0.85
7 0.8
8 0.76
9 0.74
10 0.69
11 0.64
12 0.62
13 0.54
14 0.45
15 0.42
16 0.41
17 0.35
18 0.3
19 0.26
20 0.18
21 0.17
22 0.19
23 0.19
24 0.16
25 0.17
26 0.2
27 0.23
28 0.23
29 0.22
30 0.17
31 0.18
32 0.19
33 0.24
34 0.21
35 0.23
36 0.25
37 0.25
38 0.27
39 0.26
40 0.27
41 0.24
42 0.23
43 0.19
44 0.18
45 0.19
46 0.18
47 0.23
48 0.25
49 0.23
50 0.25
51 0.29
52 0.34
53 0.37
54 0.43
55 0.47
56 0.5
57 0.57
58 0.61
59 0.57
60 0.52
61 0.48
62 0.42
63 0.34
64 0.31
65 0.23
66 0.2
67 0.24
68 0.23
69 0.22
70 0.22
71 0.24
72 0.23
73 0.28
74 0.26
75 0.25
76 0.29
77 0.3
78 0.33
79 0.32
80 0.32
81 0.28
82 0.33
83 0.37
84 0.4
85 0.42
86 0.4
87 0.39
88 0.36
89 0.35
90 0.33
91 0.34
92 0.35
93 0.36
94 0.45
95 0.46
96 0.45
97 0.47
98 0.44
99 0.43
100 0.38
101 0.34
102 0.25
103 0.24
104 0.23
105 0.22
106 0.21
107 0.16
108 0.13
109 0.13
110 0.11
111 0.11
112 0.12
113 0.12
114 0.14
115 0.15
116 0.18
117 0.2
118 0.22
119 0.21
120 0.24
121 0.27
122 0.26
123 0.24
124 0.26
125 0.25
126 0.25
127 0.29
128 0.3
129 0.31
130 0.31
131 0.31
132 0.28
133 0.31
134 0.34
135 0.32
136 0.31
137 0.27
138 0.3
139 0.31
140 0.31
141 0.28
142 0.28
143 0.27
144 0.26
145 0.29
146 0.3
147 0.31
148 0.34
149 0.37
150 0.33
151 0.31
152 0.32
153 0.31
154 0.26
155 0.25
156 0.21
157 0.2
158 0.19