Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YIS4

Protein Details
Accession A0A2T9YIS4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
163-188IEQKRAKLRKTYHSQLKKSRKFKVDYHydrophilic
NLS Segment(s)
PositionSequence
166-173KRAKLRKT
179-182KKSR
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MFHLVTISTFKKFFGLKTARFISNFDISLAQKLTCEDKYNLTKWRDSISPGKLDPKSYSMTYSRSGGPGGQNVNKLNTKAMLRMSVENQAWIPDYVKKNFVRLNKAKINKKGEYIITSEESRSQLLNSEDCIKRLCIMLKEASLFPKDPSLEKRERINKLVEIEQKRAKLRKTYHSQLKKSRKFKVDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.35
4 0.43
5 0.48
6 0.47
7 0.47
8 0.47
9 0.42
10 0.38
11 0.35
12 0.28
13 0.26
14 0.23
15 0.26
16 0.25
17 0.2
18 0.16
19 0.17
20 0.2
21 0.19
22 0.23
23 0.21
24 0.28
25 0.34
26 0.38
27 0.44
28 0.43
29 0.44
30 0.41
31 0.43
32 0.37
33 0.35
34 0.38
35 0.35
36 0.37
37 0.35
38 0.41
39 0.39
40 0.4
41 0.37
42 0.33
43 0.31
44 0.27
45 0.29
46 0.24
47 0.26
48 0.25
49 0.25
50 0.23
51 0.2
52 0.2
53 0.18
54 0.17
55 0.18
56 0.2
57 0.2
58 0.22
59 0.22
60 0.26
61 0.25
62 0.24
63 0.21
64 0.2
65 0.18
66 0.17
67 0.17
68 0.17
69 0.17
70 0.18
71 0.18
72 0.21
73 0.2
74 0.18
75 0.17
76 0.15
77 0.14
78 0.13
79 0.12
80 0.13
81 0.16
82 0.16
83 0.22
84 0.22
85 0.25
86 0.29
87 0.32
88 0.37
89 0.38
90 0.45
91 0.47
92 0.55
93 0.58
94 0.62
95 0.65
96 0.57
97 0.55
98 0.51
99 0.45
100 0.39
101 0.34
102 0.29
103 0.24
104 0.22
105 0.2
106 0.19
107 0.18
108 0.17
109 0.15
110 0.12
111 0.13
112 0.14
113 0.15
114 0.14
115 0.21
116 0.21
117 0.21
118 0.23
119 0.19
120 0.19
121 0.21
122 0.22
123 0.17
124 0.2
125 0.22
126 0.22
127 0.24
128 0.24
129 0.24
130 0.23
131 0.22
132 0.19
133 0.21
134 0.21
135 0.23
136 0.27
137 0.32
138 0.36
139 0.4
140 0.49
141 0.53
142 0.57
143 0.57
144 0.57
145 0.53
146 0.51
147 0.55
148 0.55
149 0.51
150 0.52
151 0.54
152 0.54
153 0.57
154 0.59
155 0.57
156 0.57
157 0.59
158 0.63
159 0.67
160 0.72
161 0.76
162 0.8
163 0.84
164 0.86
165 0.9
166 0.89
167 0.89
168 0.88