Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YCZ9

Protein Details
Accession A0A2T9YCZ9    Localization Confidence High Confidence Score 18.6
NoLS Segment(s)
PositionSequenceProtein Nature
100-128ARDCDNPRRRDSRSPRRPRRNYSRSYSRSHydrophilic
173-238SRSNSRSRSRSKPRRTNPNNSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPHydrophilic
256-302PPPSRYPARSRSPPRSRSRSVSRSRSNNKSRSRSRPKTRSPMSPVSRHydrophilic
NLS Segment(s)
PositionSequence
107-304RRRDSRSPRRPRRNYSRSYSRSLSRDRNSRSRGSRYRPRRADSNRRSRSRSYSASRSRSRPRHGSISRSNSRSRSRSKPRRTNPNNSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPARSRSPPPSRYPARSRSPPPSRYPARSRSPPRSRSRSVSRSRSNNKSRSRSRPKTRSPMSPVSRSR
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035542  CRIP  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0003723  F:RNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50102  RRM  
PS50158  ZF_CCHC  
CDD cd00590  RRM_SF  
Amino Acid Sequences MGSRKTQLFVGRLPRDIRSSELEDIFCFYGKLSRCDIKRGPSLCYGFIEYDDPLDAEDAIKRCHRMKLGDERIVVEYAKGSARRIDDNTCFRCGREGHWARDCDNPRRRDSRSPRRPRRNYSRSYSRSLSRDRNSRSRGSRYRPRRADSNRRSRSRSYSASRSRSRPRHGSISRSNSRSRSRSKPRRTNPNNSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPPRSRSPARSRSPPPSRYPARSRSPPPSRYPARSRSPPRSRSRSVSRSRSNNKSRSRSRPKTRSPMSPVSRSRSRSNNILRSRSRSENSTCRSDSRISRDHEERPISRTRSQTIKAQPDFEERSPAAEHNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.45
4 0.42
5 0.38
6 0.39
7 0.39
8 0.39
9 0.37
10 0.33
11 0.35
12 0.31
13 0.25
14 0.19
15 0.15
16 0.17
17 0.19
18 0.22
19 0.25
20 0.32
21 0.33
22 0.42
23 0.47
24 0.49
25 0.55
26 0.53
27 0.51
28 0.52
29 0.53
30 0.47
31 0.45
32 0.4
33 0.31
34 0.31
35 0.28
36 0.2
37 0.18
38 0.16
39 0.13
40 0.1
41 0.1
42 0.09
43 0.08
44 0.12
45 0.13
46 0.16
47 0.19
48 0.22
49 0.24
50 0.3
51 0.34
52 0.35
53 0.41
54 0.49
55 0.56
56 0.58
57 0.56
58 0.53
59 0.5
60 0.46
61 0.38
62 0.27
63 0.18
64 0.14
65 0.16
66 0.15
67 0.14
68 0.17
69 0.19
70 0.24
71 0.26
72 0.31
73 0.35
74 0.43
75 0.45
76 0.46
77 0.44
78 0.39
79 0.41
80 0.36
81 0.32
82 0.34
83 0.38
84 0.39
85 0.46
86 0.48
87 0.44
88 0.52
89 0.55
90 0.54
91 0.56
92 0.54
93 0.54
94 0.59
95 0.63
96 0.65
97 0.7
98 0.71
99 0.74
100 0.8
101 0.85
102 0.89
103 0.93
104 0.93
105 0.93
106 0.91
107 0.88
108 0.85
109 0.85
110 0.79
111 0.76
112 0.69
113 0.64
114 0.6
115 0.59
116 0.59
117 0.55
118 0.59
119 0.59
120 0.64
121 0.63
122 0.65
123 0.64
124 0.65
125 0.66
126 0.66
127 0.7
128 0.71
129 0.77
130 0.76
131 0.74
132 0.74
133 0.75
134 0.78
135 0.78
136 0.79
137 0.78
138 0.76
139 0.78
140 0.71
141 0.69
142 0.65
143 0.62
144 0.57
145 0.58
146 0.61
147 0.64
148 0.66
149 0.65
150 0.67
151 0.68
152 0.68
153 0.65
154 0.61
155 0.63
156 0.61
157 0.62
158 0.61
159 0.63
160 0.62
161 0.58
162 0.57
163 0.52
164 0.55
165 0.53
166 0.51
167 0.52
168 0.57
169 0.65
170 0.72
171 0.77
172 0.79
173 0.85
174 0.86
175 0.87
176 0.86
177 0.85
178 0.83
179 0.76
180 0.77
181 0.71
182 0.71
183 0.65
184 0.6
185 0.6
186 0.6
187 0.68
188 0.69
189 0.74
190 0.71
191 0.77
192 0.81
193 0.82
194 0.84
195 0.82
196 0.78
197 0.79
198 0.81
199 0.82
200 0.84
201 0.82
202 0.78
203 0.79
204 0.81
205 0.82
206 0.84
207 0.82
208 0.78
209 0.79
210 0.81
211 0.82
212 0.84
213 0.82
214 0.78
215 0.79
216 0.81
217 0.82
218 0.84
219 0.82
220 0.78
221 0.78
222 0.79
223 0.78
224 0.8
225 0.79
226 0.74
227 0.74
228 0.73
229 0.73
230 0.76
231 0.72
232 0.68
233 0.68
234 0.68
235 0.67
236 0.69
237 0.67
238 0.66
239 0.68
240 0.68
241 0.69
242 0.72
243 0.7
244 0.68
245 0.7
246 0.68
247 0.68
248 0.7
249 0.67
250 0.66
251 0.7
252 0.73
253 0.74
254 0.78
255 0.8
256 0.82
257 0.82
258 0.79
259 0.78
260 0.8
261 0.79
262 0.78
263 0.79
264 0.78
265 0.79
266 0.82
267 0.84
268 0.84
269 0.83
270 0.83
271 0.83
272 0.84
273 0.84
274 0.87
275 0.87
276 0.89
277 0.9
278 0.9
279 0.91
280 0.88
281 0.87
282 0.84
283 0.84
284 0.8
285 0.79
286 0.75
287 0.72
288 0.73
289 0.68
290 0.65
291 0.64
292 0.62
293 0.62
294 0.66
295 0.68
296 0.68
297 0.73
298 0.72
299 0.71
300 0.73
301 0.71
302 0.64
303 0.61
304 0.6
305 0.61
306 0.61
307 0.61
308 0.57
309 0.52
310 0.53
311 0.53
312 0.53
313 0.51
314 0.54
315 0.51
316 0.57
317 0.6
318 0.62
319 0.64
320 0.64
321 0.58
322 0.55
323 0.59
324 0.56
325 0.56
326 0.56
327 0.53
328 0.54
329 0.55
330 0.59
331 0.6
332 0.65
333 0.62
334 0.61
335 0.59
336 0.59
337 0.62
338 0.55
339 0.53
340 0.42
341 0.42
342 0.4