Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YJW6

Protein Details
Accession A0A2T9YJW6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-86TECVKGNKKFVKCRRNQFCVMHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 4, plas 2, golg 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MFSIKSILSFFVLLQALLYCTAALNKSKLDLDKRDPAASPNKPGYNYKPRCKNGEKQCNKQQNGYTECVKGNKKFVKCRRNQFCVMLNGPNAMCVAKTGGRRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.11
5 0.11
6 0.06
7 0.06
8 0.07
9 0.09
10 0.11
11 0.12
12 0.12
13 0.14
14 0.16
15 0.2
16 0.25
17 0.28
18 0.32
19 0.39
20 0.41
21 0.41
22 0.39
23 0.39
24 0.42
25 0.39
26 0.38
27 0.35
28 0.34
29 0.35
30 0.38
31 0.42
32 0.44
33 0.49
34 0.51
35 0.56
36 0.57
37 0.62
38 0.64
39 0.66
40 0.66
41 0.69
42 0.69
43 0.68
44 0.75
45 0.77
46 0.73
47 0.69
48 0.63
49 0.6
50 0.56
51 0.51
52 0.44
53 0.37
54 0.37
55 0.37
56 0.37
57 0.32
58 0.37
59 0.4
60 0.45
61 0.53
62 0.61
63 0.67
64 0.71
65 0.8
66 0.8
67 0.8
68 0.78
69 0.74
70 0.7
71 0.67
72 0.61
73 0.54
74 0.45
75 0.41
76 0.36
77 0.31
78 0.24
79 0.17
80 0.14
81 0.1
82 0.13
83 0.15