Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YFE1

Protein Details
Accession A0A2T9YFE1   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
128-150IGNAQKFKENKKKSKKEPSEISSHydrophilic
255-287VSGTKKLDKMLEKKRKRNAAKEHKQMPYKRRSTBasic
NLS Segment(s)
PositionSequence
124-154KAKKIGNAQKFKENKKKSKKEPSEISSKKRV
222-224KKR
233-234KK
257-285GTKKLDKMLEKKRKRNAAKEHKQMPYKRR
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MGVQHGVAPTKFLYNSEQSKKIFPKQSAQKNSESDNSYSQSSDSEEGNYSDFDSEAENQSDTELLDSKKAELKSELSKLSFEQILELKKKVGSKEFDKIFKNDSSAKNTDDSQSLSSTNNYPAKAKKIGNAQKFKENKKKSKKEPSEISSKKRVKSVWQIMDPAGNKPLDPRFEKSSGHLNLDLFKKSYSFIDKYQDSEIQTSRRHAEEYQGKLDEIKKMHKKREYDLIKQGKKPYFLKRSSLKEIELAKKFEQVSGTKKLDKMLEKKRKRNAAKEHKQMPYKRRSTAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.37
3 0.42
4 0.48
5 0.46
6 0.54
7 0.59
8 0.63
9 0.63
10 0.58
11 0.61
12 0.65
13 0.74
14 0.75
15 0.73
16 0.71
17 0.67
18 0.67
19 0.64
20 0.58
21 0.5
22 0.45
23 0.42
24 0.36
25 0.33
26 0.28
27 0.23
28 0.21
29 0.2
30 0.16
31 0.16
32 0.16
33 0.16
34 0.17
35 0.16
36 0.14
37 0.13
38 0.12
39 0.1
40 0.11
41 0.12
42 0.14
43 0.15
44 0.14
45 0.14
46 0.14
47 0.14
48 0.12
49 0.11
50 0.11
51 0.11
52 0.13
53 0.14
54 0.15
55 0.2
56 0.21
57 0.21
58 0.2
59 0.24
60 0.27
61 0.32
62 0.33
63 0.29
64 0.29
65 0.28
66 0.28
67 0.25
68 0.19
69 0.17
70 0.17
71 0.22
72 0.24
73 0.24
74 0.22
75 0.23
76 0.26
77 0.27
78 0.3
79 0.3
80 0.32
81 0.4
82 0.44
83 0.47
84 0.47
85 0.46
86 0.44
87 0.39
88 0.37
89 0.36
90 0.35
91 0.36
92 0.35
93 0.35
94 0.32
95 0.32
96 0.3
97 0.25
98 0.22
99 0.17
100 0.16
101 0.16
102 0.15
103 0.15
104 0.15
105 0.19
106 0.21
107 0.2
108 0.21
109 0.23
110 0.27
111 0.31
112 0.31
113 0.29
114 0.36
115 0.44
116 0.5
117 0.56
118 0.53
119 0.56
120 0.61
121 0.65
122 0.65
123 0.66
124 0.67
125 0.71
126 0.78
127 0.79
128 0.85
129 0.85
130 0.83
131 0.82
132 0.76
133 0.76
134 0.71
135 0.67
136 0.66
137 0.62
138 0.55
139 0.51
140 0.48
141 0.43
142 0.48
143 0.52
144 0.49
145 0.46
146 0.46
147 0.42
148 0.46
149 0.4
150 0.31
151 0.24
152 0.17
153 0.15
154 0.16
155 0.19
156 0.2
157 0.22
158 0.25
159 0.28
160 0.3
161 0.31
162 0.31
163 0.36
164 0.34
165 0.34
166 0.31
167 0.26
168 0.28
169 0.3
170 0.29
171 0.2
172 0.18
173 0.16
174 0.15
175 0.18
176 0.19
177 0.19
178 0.21
179 0.27
180 0.28
181 0.3
182 0.32
183 0.33
184 0.28
185 0.28
186 0.28
187 0.26
188 0.28
189 0.29
190 0.28
191 0.26
192 0.27
193 0.24
194 0.3
195 0.33
196 0.36
197 0.39
198 0.37
199 0.36
200 0.36
201 0.38
202 0.34
203 0.29
204 0.34
205 0.39
206 0.45
207 0.54
208 0.58
209 0.6
210 0.6
211 0.67
212 0.65
213 0.63
214 0.66
215 0.68
216 0.68
217 0.69
218 0.73
219 0.67
220 0.66
221 0.65
222 0.65
223 0.64
224 0.62
225 0.64
226 0.64
227 0.68
228 0.7
229 0.67
230 0.58
231 0.54
232 0.58
233 0.58
234 0.55
235 0.52
236 0.44
237 0.46
238 0.45
239 0.41
240 0.38
241 0.33
242 0.34
243 0.38
244 0.42
245 0.41
246 0.42
247 0.44
248 0.46
249 0.5
250 0.54
251 0.56
252 0.62
253 0.68
254 0.77
255 0.83
256 0.87
257 0.87
258 0.88
259 0.88
260 0.89
261 0.89
262 0.9
263 0.9
264 0.88
265 0.87
266 0.86
267 0.84
268 0.84
269 0.8
270 0.77