Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y6T8

Protein Details
Accession A0A2T9Y6T8   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-33GITYAKAKVKKKTVKRVSVKRLLYKNHydrophilic
NLS Segment(s)
PositionSequence
15-23KVKKKTVKR
Subcellular Location(s) mito 11, nucl 9, cyto_nucl 8.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MDPPLLSGITYAKAKVKKKTVKRVSVKRLLYKNLAQEPIIMLRMFGGKDRLSLDLTNFKEKKDEVVDTISKDITLDNVSYLHNKKSNKMFIEFDCAVDAENFKQKKNAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.5
4 0.56
5 0.65
6 0.75
7 0.79
8 0.82
9 0.87
10 0.89
11 0.89
12 0.88
13 0.85
14 0.82
15 0.78
16 0.72
17 0.67
18 0.6
19 0.57
20 0.53
21 0.48
22 0.39
23 0.34
24 0.3
25 0.27
26 0.24
27 0.17
28 0.11
29 0.1
30 0.11
31 0.1
32 0.1
33 0.11
34 0.09
35 0.11
36 0.12
37 0.13
38 0.13
39 0.13
40 0.14
41 0.19
42 0.2
43 0.28
44 0.27
45 0.25
46 0.26
47 0.26
48 0.28
49 0.24
50 0.24
51 0.17
52 0.22
53 0.23
54 0.22
55 0.24
56 0.2
57 0.16
58 0.15
59 0.13
60 0.09
61 0.09
62 0.08
63 0.07
64 0.08
65 0.09
66 0.15
67 0.17
68 0.21
69 0.25
70 0.26
71 0.32
72 0.4
73 0.47
74 0.45
75 0.47
76 0.47
77 0.43
78 0.51
79 0.45
80 0.37
81 0.3
82 0.26
83 0.23
84 0.2
85 0.19
86 0.14
87 0.22
88 0.23
89 0.23