Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YAL2

Protein Details
Accession A0A2T9YAL2    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
57-81IEARKKFKAETRKKRKINSHLMTKKBasic
NLS Segment(s)
PositionSequence
58-74EARKKFKAETRKKRKIN
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MKLEKGAKESQEERKVKKMENGKERQYRPNPFERQLQAKRKIAEEVQAESERRTAEIEARKKFKAETRKKRKINSHLMTKKTSKGQPVISSQISLLLGKIESVKSVNRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.6
4 0.61
5 0.61
6 0.6
7 0.65
8 0.68
9 0.69
10 0.74
11 0.75
12 0.77
13 0.76
14 0.75
15 0.7
16 0.72
17 0.69
18 0.62
19 0.66
20 0.6
21 0.61
22 0.62
23 0.66
24 0.64
25 0.63
26 0.61
27 0.54
28 0.52
29 0.43
30 0.4
31 0.32
32 0.27
33 0.26
34 0.26
35 0.25
36 0.23
37 0.23
38 0.17
39 0.15
40 0.14
41 0.1
42 0.14
43 0.21
44 0.28
45 0.32
46 0.35
47 0.35
48 0.35
49 0.37
50 0.38
51 0.41
52 0.45
53 0.51
54 0.59
55 0.69
56 0.76
57 0.82
58 0.86
59 0.85
60 0.85
61 0.81
62 0.81
63 0.78
64 0.76
65 0.73
66 0.67
67 0.61
68 0.58
69 0.54
70 0.49
71 0.47
72 0.49
73 0.48
74 0.5
75 0.51
76 0.45
77 0.41
78 0.35
79 0.32
80 0.27
81 0.22
82 0.16
83 0.12
84 0.1
85 0.1
86 0.13
87 0.1
88 0.11
89 0.13