Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9XX83

Protein Details
Accession A0A2T9XX83   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-61LLTTITKAKNKRSIKRRSAKFFEFWHydrophilic
NLS Segment(s)
PositionSequence
45-53KNKRSIKRR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.833, cyto 4, cyto_mito 3.333, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028994  Integrin_alpha_N  
IPR024881  Tip  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences KILPGERLDLIDPTFEGPQPVHIQLGDFDNDGFPDLLLTTITKAKNKRSIKRRSAKFFEFWDSLFGAKKQIEVDSNSKIRLLRNVPLLVDNKPVKGKRTFELIKDEQIIKGLREINSPTRAIFFDMDENGTLDILVSYLDNKKKPKLMVMQNSFDTASSFFIKPSLCPEFGDSENKNDLSYMYGGSFTCILSSGTKSLVMTGVQYPQQSYRSIQQPYSFFGLGEFNNYVDKIYIGSTQGKVYSFESLIPNSRLFFRVDLTQKLKPILLLPNAKNSHTIILGLVVTVFCLVGIIFFLNKLEKEADLREKQKQLFWINFDAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.15
4 0.13
5 0.18
6 0.21
7 0.22
8 0.21
9 0.19
10 0.2
11 0.2
12 0.23
13 0.19
14 0.15
15 0.15
16 0.14
17 0.14
18 0.14
19 0.13
20 0.09
21 0.08
22 0.08
23 0.07
24 0.08
25 0.08
26 0.08
27 0.14
28 0.17
29 0.23
30 0.28
31 0.36
32 0.46
33 0.55
34 0.63
35 0.68
36 0.76
37 0.81
38 0.86
39 0.88
40 0.88
41 0.87
42 0.83
43 0.78
44 0.71
45 0.67
46 0.59
47 0.49
48 0.42
49 0.33
50 0.29
51 0.26
52 0.21
53 0.19
54 0.17
55 0.18
56 0.17
57 0.19
58 0.21
59 0.23
60 0.27
61 0.3
62 0.32
63 0.31
64 0.32
65 0.31
66 0.29
67 0.32
68 0.32
69 0.29
70 0.33
71 0.34
72 0.33
73 0.36
74 0.36
75 0.3
76 0.34
77 0.3
78 0.26
79 0.32
80 0.33
81 0.33
82 0.37
83 0.39
84 0.34
85 0.42
86 0.42
87 0.39
88 0.46
89 0.43
90 0.4
91 0.41
92 0.39
93 0.3
94 0.3
95 0.28
96 0.19
97 0.21
98 0.21
99 0.18
100 0.2
101 0.23
102 0.25
103 0.28
104 0.28
105 0.24
106 0.22
107 0.22
108 0.21
109 0.19
110 0.14
111 0.13
112 0.13
113 0.14
114 0.12
115 0.12
116 0.1
117 0.09
118 0.08
119 0.05
120 0.04
121 0.04
122 0.03
123 0.03
124 0.04
125 0.09
126 0.13
127 0.16
128 0.19
129 0.22
130 0.26
131 0.27
132 0.32
133 0.36
134 0.42
135 0.48
136 0.51
137 0.51
138 0.47
139 0.48
140 0.41
141 0.33
142 0.24
143 0.15
144 0.11
145 0.11
146 0.11
147 0.09
148 0.11
149 0.11
150 0.11
151 0.15
152 0.17
153 0.15
154 0.15
155 0.17
156 0.18
157 0.2
158 0.26
159 0.21
160 0.21
161 0.23
162 0.23
163 0.21
164 0.18
165 0.16
166 0.12
167 0.12
168 0.09
169 0.07
170 0.08
171 0.08
172 0.08
173 0.09
174 0.07
175 0.06
176 0.06
177 0.07
178 0.07
179 0.08
180 0.08
181 0.09
182 0.09
183 0.09
184 0.09
185 0.09
186 0.08
187 0.09
188 0.09
189 0.11
190 0.12
191 0.13
192 0.13
193 0.15
194 0.17
195 0.17
196 0.17
197 0.21
198 0.26
199 0.29
200 0.3
201 0.32
202 0.32
203 0.33
204 0.35
205 0.29
206 0.22
207 0.21
208 0.21
209 0.16
210 0.18
211 0.16
212 0.12
213 0.13
214 0.13
215 0.12
216 0.1
217 0.1
218 0.07
219 0.08
220 0.09
221 0.11
222 0.14
223 0.15
224 0.15
225 0.17
226 0.17
227 0.18
228 0.17
229 0.18
230 0.15
231 0.17
232 0.19
233 0.19
234 0.22
235 0.23
236 0.23
237 0.21
238 0.22
239 0.21
240 0.2
241 0.19
242 0.17
243 0.23
244 0.26
245 0.33
246 0.36
247 0.38
248 0.39
249 0.4
250 0.38
251 0.31
252 0.31
253 0.3
254 0.32
255 0.37
256 0.37
257 0.45
258 0.46
259 0.46
260 0.44
261 0.39
262 0.34
263 0.26
264 0.25
265 0.15
266 0.15
267 0.14
268 0.12
269 0.11
270 0.08
271 0.07
272 0.07
273 0.06
274 0.04
275 0.04
276 0.04
277 0.03
278 0.04
279 0.05
280 0.05
281 0.06
282 0.08
283 0.1
284 0.11
285 0.13
286 0.14
287 0.15
288 0.18
289 0.25
290 0.33
291 0.39
292 0.44
293 0.5
294 0.56
295 0.58
296 0.58
297 0.6
298 0.59
299 0.57
300 0.57