Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YTN1

Protein Details
Accession A0A2T9YTN1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-119KIGTKKIRWYFKRMKKVAKKHKVFNPEYKKKKIKBasic
NLS Segment(s)
PositionSequence
90-119KKIRWYFKRMKKVAKKHKVFNPEYKKKKIK
Subcellular Location(s) nucl 9.5, cyto_nucl 9.333, cyto 8, cyto_mito 7.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MIDDKKVEFYKSIDIKSEVLNISITNGNGVEFGTLFNSSNEVLSKIGTIHDIDAWRFGKRNICASNNVNIFFTPNIPVLEMPNTFKIGTKKIRWYFKRMKKVAKKHKVFNPEYKKKKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.34
4 0.36
5 0.27
6 0.22
7 0.21
8 0.16
9 0.17
10 0.17
11 0.15
12 0.11
13 0.11
14 0.1
15 0.1
16 0.1
17 0.07
18 0.05
19 0.06
20 0.06
21 0.07
22 0.07
23 0.07
24 0.09
25 0.08
26 0.09
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.08
35 0.07
36 0.07
37 0.09
38 0.09
39 0.09
40 0.13
41 0.14
42 0.13
43 0.14
44 0.15
45 0.18
46 0.19
47 0.26
48 0.26
49 0.27
50 0.31
51 0.33
52 0.38
53 0.34
54 0.34
55 0.27
56 0.23
57 0.22
58 0.18
59 0.16
60 0.11
61 0.11
62 0.1
63 0.1
64 0.11
65 0.11
66 0.14
67 0.14
68 0.14
69 0.15
70 0.16
71 0.16
72 0.19
73 0.21
74 0.25
75 0.32
76 0.36
77 0.44
78 0.5
79 0.61
80 0.62
81 0.69
82 0.72
83 0.75
84 0.8
85 0.77
86 0.8
87 0.81
88 0.88
89 0.89
90 0.89
91 0.87
92 0.86
93 0.87
94 0.87
95 0.83
96 0.83
97 0.83
98 0.83
99 0.84