Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Y9Z0

Protein Details
Accession A0A2T9Y9Z0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-84TVYKAEIKFKKRRRRTDSKRRALPTNSHydrophilic
NLS Segment(s)
PositionSequence
65-78KFKKRRRRTDSKRR
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MPCILKGNVGPKHTAVGARIRYDKHRSLRGPQCTASKSSRTTSFGIDVKESHSYTFPTVYKAEIKFKKRRRRTDSKRRALPTNSVNDTNQIRQLILWQLNSAKYLTEITPEIVTKFTEDEDNLGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.27
4 0.29
5 0.32
6 0.35
7 0.36
8 0.41
9 0.47
10 0.52
11 0.51
12 0.56
13 0.55
14 0.61
15 0.67
16 0.68
17 0.66
18 0.61
19 0.6
20 0.54
21 0.54
22 0.49
23 0.44
24 0.39
25 0.39
26 0.39
27 0.37
28 0.36
29 0.33
30 0.33
31 0.31
32 0.29
33 0.26
34 0.21
35 0.2
36 0.22
37 0.2
38 0.16
39 0.15
40 0.14
41 0.14
42 0.18
43 0.16
44 0.14
45 0.15
46 0.15
47 0.19
48 0.2
49 0.28
50 0.3
51 0.37
52 0.44
53 0.53
54 0.63
55 0.68
56 0.77
57 0.78
58 0.83
59 0.87
60 0.89
61 0.91
62 0.9
63 0.89
64 0.83
65 0.8
66 0.72
67 0.68
68 0.63
69 0.59
70 0.52
71 0.46
72 0.42
73 0.39
74 0.39
75 0.34
76 0.31
77 0.23
78 0.2
79 0.17
80 0.2
81 0.22
82 0.22
83 0.2
84 0.18
85 0.2
86 0.21
87 0.22
88 0.2
89 0.13
90 0.12
91 0.14
92 0.12
93 0.13
94 0.14
95 0.14
96 0.17
97 0.17
98 0.17
99 0.16
100 0.16
101 0.14
102 0.14
103 0.14
104 0.15
105 0.15
106 0.18
107 0.23