Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YI10

Protein Details
Accession A0A2T9YI10    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-42MQKTVKVRVPKRKIHPIVRKEBasic
NLS Segment(s)
PositionSequence
32-34KRK
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MLPSTTLLSRINFTGMVVGTAMQKTVKVRVPKRKIHPIVRKEILRHKNYLAHDELEKCKLGDIVRIESCHKISTRKSFAVAEIIRKGKFYIDPETGKELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.1
5 0.1
6 0.1
7 0.1
8 0.11
9 0.08
10 0.09
11 0.1
12 0.15
13 0.21
14 0.28
15 0.37
16 0.47
17 0.56
18 0.63
19 0.7
20 0.76
21 0.79
22 0.8
23 0.82
24 0.78
25 0.78
26 0.75
27 0.7
28 0.63
29 0.64
30 0.62
31 0.55
32 0.51
33 0.44
34 0.44
35 0.42
36 0.41
37 0.33
38 0.26
39 0.25
40 0.25
41 0.25
42 0.21
43 0.2
44 0.16
45 0.15
46 0.15
47 0.14
48 0.15
49 0.16
50 0.19
51 0.21
52 0.22
53 0.24
54 0.24
55 0.25
56 0.23
57 0.22
58 0.23
59 0.28
60 0.36
61 0.41
62 0.4
63 0.42
64 0.4
65 0.4
66 0.44
67 0.39
68 0.35
69 0.35
70 0.37
71 0.35
72 0.34
73 0.33
74 0.28
75 0.3
76 0.29
77 0.3
78 0.33
79 0.36
80 0.39