Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YP26

Protein Details
Accession A0A2T9YP26   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
210-229MYKSSERATKKFKPKPNIDLHydrophilic
NLS Segment(s)
PositionSequence
80-91NPPKKTSKRLSS
Subcellular Location(s) cyto 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR016848  RNase_P/MRP_Rpp29-subunit  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023534  Rof/RNase_P-like  
IPR002730  Rpp29/RNP1  
Gene Ontology GO:0005634  C:nucleus  
GO:0000172  C:ribonuclease MRP complex  
GO:0030677  C:ribonuclease P complex  
GO:0033204  F:ribonuclease P RNA binding  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01868  RNase_P-MRP_p29  
Amino Acid Sequences MDIYSEIPEYVKKNVPLELGVPLNEYTKTFTKDYVLELLPSNVKKDKIYETKVERKVVSLQSNKRIEEENNLKSKKEQINPPKKTSKRLSSKLQKKLGIYNIPKDNQKYSVFEPLNVLWSEYILRVLANSTGPNAAQKIIKADFHGSILSVVKAKCYSLVGKEGIVIQETKNTFKIITKTNNLLVIPKTNTIFEMKVSSYKFTFFGNQIMYKSSERATKKFKPKPNIDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.31
4 0.3
5 0.29
6 0.25
7 0.22
8 0.21
9 0.19
10 0.19
11 0.18
12 0.17
13 0.17
14 0.2
15 0.24
16 0.23
17 0.24
18 0.26
19 0.27
20 0.29
21 0.29
22 0.25
23 0.22
24 0.22
25 0.23
26 0.25
27 0.24
28 0.25
29 0.24
30 0.24
31 0.24
32 0.27
33 0.34
34 0.38
35 0.42
36 0.47
37 0.52
38 0.6
39 0.65
40 0.66
41 0.57
42 0.5
43 0.52
44 0.5
45 0.5
46 0.49
47 0.5
48 0.55
49 0.59
50 0.57
51 0.52
52 0.48
53 0.4
54 0.41
55 0.43
56 0.41
57 0.45
58 0.45
59 0.44
60 0.42
61 0.5
62 0.48
63 0.46
64 0.49
65 0.51
66 0.61
67 0.67
68 0.73
69 0.75
70 0.7
71 0.72
72 0.7
73 0.69
74 0.68
75 0.68
76 0.72
77 0.72
78 0.79
79 0.8
80 0.79
81 0.72
82 0.64
83 0.63
84 0.59
85 0.57
86 0.5
87 0.47
88 0.46
89 0.44
90 0.45
91 0.41
92 0.37
93 0.33
94 0.32
95 0.28
96 0.25
97 0.32
98 0.29
99 0.28
100 0.28
101 0.23
102 0.24
103 0.21
104 0.19
105 0.09
106 0.09
107 0.1
108 0.08
109 0.08
110 0.05
111 0.05
112 0.04
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.08
121 0.08
122 0.09
123 0.09
124 0.09
125 0.12
126 0.13
127 0.14
128 0.15
129 0.16
130 0.15
131 0.16
132 0.15
133 0.11
134 0.11
135 0.11
136 0.1
137 0.11
138 0.1
139 0.11
140 0.12
141 0.11
142 0.11
143 0.13
144 0.14
145 0.14
146 0.18
147 0.17
148 0.17
149 0.18
150 0.18
151 0.16
152 0.15
153 0.13
154 0.09
155 0.14
156 0.15
157 0.17
158 0.17
159 0.17
160 0.17
161 0.2
162 0.25
163 0.27
164 0.33
165 0.36
166 0.39
167 0.41
168 0.44
169 0.4
170 0.38
171 0.33
172 0.31
173 0.28
174 0.28
175 0.26
176 0.23
177 0.24
178 0.24
179 0.23
180 0.18
181 0.2
182 0.18
183 0.23
184 0.24
185 0.26
186 0.23
187 0.25
188 0.24
189 0.22
190 0.25
191 0.22
192 0.25
193 0.27
194 0.29
195 0.28
196 0.3
197 0.32
198 0.29
199 0.29
200 0.27
201 0.3
202 0.33
203 0.4
204 0.46
205 0.53
206 0.62
207 0.7
208 0.76
209 0.79