Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YG43

Protein Details
Accession A0A2T9YG43   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-38DCNAADNHWRRKPKYNSKENLNSEYHydrophilic
182-205YLRINCKWVGYRKKKTTKLTISLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 11.833, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences MCWNCGIKSYLKRDCNAADNHWRRKPKYNSKENLNSEYQSGKAQHQEKKLSQDIYGVEGEMSLSAPQIKSPPKESITNVESNNKIFKNTQYNSDPDMDLEYFSASGNIENFNRPVEKSKKKYKFSIFDNLIQPKAKLIRVSLIDHAETIQMENINIKNPNIPIWTMQSGITEMQNPRNRSEYLRINCKWVGYRKKKTTKLTISLENCEISISAFIFPLKNVDLILGIDWWVKYKLTPQYETNTWKIEVDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.53
4 0.5
5 0.52
6 0.56
7 0.65
8 0.67
9 0.72
10 0.69
11 0.75
12 0.79
13 0.79
14 0.8
15 0.82
16 0.82
17 0.84
18 0.89
19 0.85
20 0.8
21 0.73
22 0.63
23 0.54
24 0.47
25 0.38
26 0.32
27 0.28
28 0.25
29 0.29
30 0.35
31 0.4
32 0.46
33 0.53
34 0.52
35 0.58
36 0.6
37 0.54
38 0.47
39 0.44
40 0.37
41 0.33
42 0.29
43 0.21
44 0.15
45 0.13
46 0.13
47 0.09
48 0.08
49 0.05
50 0.05
51 0.06
52 0.06
53 0.07
54 0.12
55 0.17
56 0.2
57 0.24
58 0.29
59 0.31
60 0.35
61 0.36
62 0.39
63 0.38
64 0.4
65 0.38
66 0.37
67 0.35
68 0.33
69 0.36
70 0.29
71 0.27
72 0.23
73 0.26
74 0.31
75 0.31
76 0.36
77 0.34
78 0.36
79 0.37
80 0.38
81 0.32
82 0.23
83 0.24
84 0.18
85 0.15
86 0.12
87 0.1
88 0.08
89 0.08
90 0.08
91 0.05
92 0.05
93 0.06
94 0.07
95 0.08
96 0.09
97 0.09
98 0.1
99 0.11
100 0.11
101 0.18
102 0.25
103 0.33
104 0.39
105 0.5
106 0.58
107 0.62
108 0.69
109 0.7
110 0.68
111 0.64
112 0.67
113 0.59
114 0.55
115 0.56
116 0.5
117 0.44
118 0.37
119 0.32
120 0.24
121 0.24
122 0.2
123 0.15
124 0.14
125 0.16
126 0.19
127 0.21
128 0.21
129 0.2
130 0.19
131 0.18
132 0.18
133 0.14
134 0.11
135 0.09
136 0.08
137 0.06
138 0.06
139 0.08
140 0.09
141 0.11
142 0.12
143 0.12
144 0.14
145 0.14
146 0.16
147 0.15
148 0.15
149 0.14
150 0.18
151 0.19
152 0.17
153 0.17
154 0.15
155 0.15
156 0.15
157 0.14
158 0.14
159 0.14
160 0.23
161 0.29
162 0.3
163 0.31
164 0.34
165 0.34
166 0.35
167 0.4
168 0.41
169 0.42
170 0.5
171 0.48
172 0.5
173 0.49
174 0.47
175 0.46
176 0.46
177 0.5
178 0.51
179 0.61
180 0.67
181 0.76
182 0.83
183 0.84
184 0.86
185 0.84
186 0.82
187 0.77
188 0.76
189 0.7
190 0.66
191 0.6
192 0.49
193 0.4
194 0.31
195 0.25
196 0.16
197 0.13
198 0.1
199 0.08
200 0.09
201 0.1
202 0.1
203 0.1
204 0.12
205 0.12
206 0.11
207 0.11
208 0.11
209 0.11
210 0.11
211 0.12
212 0.09
213 0.09
214 0.1
215 0.1
216 0.12
217 0.12
218 0.12
219 0.12
220 0.19
221 0.27
222 0.32
223 0.37
224 0.39
225 0.45
226 0.53
227 0.58
228 0.55
229 0.5
230 0.44