Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YM17

Protein Details
Accession A0A2T9YM17    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-98RNNLKGEDRDKNRKPRGRGRGRGRGRBasic
NLS Segment(s)
PositionSequence
77-98KGEDRDKNRKPRGRGRGRGRGR
Subcellular Location(s) nucl 12.5, cyto_nucl 7.5, mito 5, pero 3, extr 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034101  Lsm4  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0120114  C:Sm-like protein family complex  
GO:0005681  C:spliceosomal complex  
GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd01723  LSm4  
Amino Acid Sequences MLPISILQTAVGHPILVELKNGQTYNGHLESCDFAMNLLLREVIQTSVDGERFWRWSEMNVLDKAREKSLENRNNLKGEDRDKNRKPRGRGRGRGRGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.12
5 0.11
6 0.13
7 0.17
8 0.17
9 0.16
10 0.14
11 0.16
12 0.21
13 0.22
14 0.2
15 0.16
16 0.17
17 0.18
18 0.18
19 0.16
20 0.09
21 0.07
22 0.09
23 0.1
24 0.09
25 0.08
26 0.07
27 0.06
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.06
34 0.07
35 0.08
36 0.07
37 0.08
38 0.09
39 0.1
40 0.11
41 0.11
42 0.1
43 0.11
44 0.16
45 0.18
46 0.21
47 0.23
48 0.23
49 0.23
50 0.27
51 0.28
52 0.25
53 0.23
54 0.21
55 0.27
56 0.38
57 0.44
58 0.46
59 0.51
60 0.54
61 0.55
62 0.54
63 0.51
64 0.46
65 0.45
66 0.49
67 0.5
68 0.56
69 0.62
70 0.72
71 0.77
72 0.8
73 0.82
74 0.83
75 0.85
76 0.86
77 0.88
78 0.87