Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Y1X2

Protein Details
Accession A0A2T9Y1X2    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-73FPTQNNQKIKKPQKNLKKIIKKTTCPHydrophilic
NLS Segment(s)
PositionSequence
61-61K
Subcellular Location(s) mito 21.5, mito_nucl 12.833, cyto_nucl 3.333, nucl 3
Family & Domain DBs
Amino Acid Sequences MPRVPGVIPSAVAGVPYHSAKRTRLEYSTVAKTGLIDPASKNYYHFNFPTQNNQKIKKPQKNLKKIIKKTTCPQLQKFMLESTLEVSIKHLLDGSEPQISGVIPSAAAGVPLIPTKRTRLEYSTVAKTGYIDPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.13
4 0.15
5 0.17
6 0.21
7 0.23
8 0.3
9 0.34
10 0.35
11 0.36
12 0.39
13 0.41
14 0.43
15 0.46
16 0.4
17 0.35
18 0.3
19 0.28
20 0.25
21 0.23
22 0.18
23 0.13
24 0.13
25 0.18
26 0.2
27 0.19
28 0.19
29 0.2
30 0.22
31 0.24
32 0.25
33 0.24
34 0.29
35 0.31
36 0.4
37 0.42
38 0.48
39 0.5
40 0.53
41 0.55
42 0.59
43 0.68
44 0.66
45 0.68
46 0.69
47 0.74
48 0.81
49 0.84
50 0.84
51 0.84
52 0.81
53 0.82
54 0.81
55 0.74
56 0.69
57 0.7
58 0.67
59 0.62
60 0.58
61 0.56
62 0.5
63 0.48
64 0.44
65 0.35
66 0.28
67 0.23
68 0.2
69 0.13
70 0.14
71 0.12
72 0.1
73 0.11
74 0.12
75 0.12
76 0.12
77 0.11
78 0.09
79 0.1
80 0.12
81 0.13
82 0.12
83 0.12
84 0.12
85 0.12
86 0.12
87 0.11
88 0.1
89 0.07
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.05
96 0.05
97 0.06
98 0.09
99 0.1
100 0.11
101 0.13
102 0.18
103 0.25
104 0.29
105 0.33
106 0.35
107 0.39
108 0.45
109 0.49
110 0.5
111 0.45
112 0.41
113 0.36
114 0.34