Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2UB88

Protein Details
Accession Q2UB88    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
121-144LDRLRWYCSKGKHKKPTIIREEIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 7.5, cysk 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010329  3hydroanth_dOase  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000334  F:3-hydroxyanthranilate 3,4-dioxygenase activity  
GO:0008198  F:ferrous iron binding  
GO:0034354  P:'de novo' NAD biosynthetic process from tryptophan  
GO:0043420  P:anthranilate metabolic process  
GO:0019805  P:quinolinate biosynthetic process  
GO:0006569  P:tryptophan catabolic process  
Pfam View protein in Pfam  
PF06052  3-HAO  
CDD cd06123  cupin_HAO  
Amino Acid Sequences MIPPFSFASWVAENEDKLHPPVNNYCLYSGEDFTLMVVGGPNSRNDYHGVFIMVVNQTEEWFYQVKGDMLLRIVENNTTFRDISIKEGEMFLLPGNTPHNPVRFRDTIGLVMERKRPEDSLDRLRWYCSKGKHKKPTIIREEIFHCADLGTQLKPLIERWQIDEESRRCGACGAIADPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.24
4 0.24
5 0.27
6 0.23
7 0.26
8 0.32
9 0.33
10 0.33
11 0.33
12 0.32
13 0.3
14 0.31
15 0.29
16 0.24
17 0.2
18 0.16
19 0.15
20 0.13
21 0.12
22 0.09
23 0.06
24 0.06
25 0.05
26 0.07
27 0.08
28 0.1
29 0.13
30 0.13
31 0.14
32 0.16
33 0.17
34 0.17
35 0.17
36 0.16
37 0.13
38 0.13
39 0.15
40 0.13
41 0.11
42 0.1
43 0.1
44 0.09
45 0.09
46 0.09
47 0.08
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.1
54 0.1
55 0.09
56 0.09
57 0.1
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.1
68 0.13
69 0.12
70 0.15
71 0.15
72 0.15
73 0.13
74 0.13
75 0.13
76 0.11
77 0.11
78 0.07
79 0.05
80 0.05
81 0.05
82 0.07
83 0.07
84 0.11
85 0.13
86 0.17
87 0.18
88 0.2
89 0.26
90 0.25
91 0.27
92 0.26
93 0.25
94 0.23
95 0.23
96 0.24
97 0.19
98 0.21
99 0.24
100 0.22
101 0.23
102 0.22
103 0.21
104 0.22
105 0.28
106 0.32
107 0.37
108 0.41
109 0.44
110 0.43
111 0.45
112 0.43
113 0.41
114 0.4
115 0.39
116 0.46
117 0.52
118 0.62
119 0.7
120 0.76
121 0.81
122 0.84
123 0.86
124 0.83
125 0.82
126 0.72
127 0.66
128 0.61
129 0.57
130 0.49
131 0.38
132 0.29
133 0.2
134 0.19
135 0.18
136 0.16
137 0.12
138 0.12
139 0.12
140 0.13
141 0.14
142 0.15
143 0.2
144 0.23
145 0.24
146 0.28
147 0.33
148 0.34
149 0.37
150 0.45
151 0.39
152 0.4
153 0.41
154 0.36
155 0.3
156 0.29
157 0.26
158 0.2
159 0.22