Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y7K4

Protein Details
Accession A0A2T9Y7K4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
97-129MGASQSTSRKQRKEKKNRLKKLRGTAKVKGAKKHydrophilic
NLS Segment(s)
PositionSequence
104-132SRKQRKEKKNRLKKLRGTAKVKGAKKRKE
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEGSVTLRTRKFVTNRLLSRRQMILDVIHPGLAGVSKNDIRDKLAVMYKADKEAIFVFGFKIHYGGGKSTGFALVYDNLDSAKKFEPKYRLIRHGMGASQSTSRKQRKEKKNRLKKLRGTAKVKGAKKRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.6
4 0.66
5 0.71
6 0.65
7 0.65
8 0.59
9 0.51
10 0.43
11 0.36
12 0.3
13 0.24
14 0.25
15 0.2
16 0.17
17 0.16
18 0.14
19 0.12
20 0.11
21 0.09
22 0.06
23 0.09
24 0.11
25 0.13
26 0.16
27 0.16
28 0.17
29 0.18
30 0.19
31 0.19
32 0.21
33 0.21
34 0.2
35 0.23
36 0.22
37 0.23
38 0.22
39 0.18
40 0.16
41 0.15
42 0.15
43 0.12
44 0.11
45 0.1
46 0.1
47 0.11
48 0.09
49 0.09
50 0.07
51 0.08
52 0.08
53 0.08
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.09
62 0.07
63 0.08
64 0.08
65 0.07
66 0.08
67 0.08
68 0.08
69 0.09
70 0.13
71 0.16
72 0.18
73 0.24
74 0.29
75 0.36
76 0.46
77 0.51
78 0.54
79 0.55
80 0.56
81 0.53
82 0.5
83 0.44
84 0.36
85 0.3
86 0.24
87 0.23
88 0.23
89 0.25
90 0.32
91 0.38
92 0.44
93 0.53
94 0.62
95 0.7
96 0.79
97 0.86
98 0.88
99 0.92
100 0.95
101 0.95
102 0.95
103 0.94
104 0.93
105 0.93
106 0.91
107 0.87
108 0.84
109 0.83
110 0.82
111 0.79
112 0.78