Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Y608

Protein Details
Accession A0A2T9Y608    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
177-204AGNFRKRLFLKRRYEKPFAKRRREASEAHydrophilic
NLS Segment(s)
PositionSequence
181-216RKRLFLKRRYEKPFAKRRREASEANARRVKKEVASK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MILKSLNLCSINSKFLARSGNTNFRAFSNSFRIQDSKAPNSGASDSTNINPQPLNNNTLSAHIGQKDFITNILGQAEQPSIPKDRNTEQLNNSIDKKFLGKYNRFSDITRNSMGQSYNQNNYGSQKFMNTPKKQNSDTNSNSIAFNLSLGIDSGRSVAVLGDSPLRAFNNLKNVLNAGNFRKRLFLKRRYEKPFAKRRREASEANARRVKKEVASKVRTVLRMKGWGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.32
4 0.27
5 0.33
6 0.38
7 0.46
8 0.48
9 0.49
10 0.46
11 0.4
12 0.44
13 0.37
14 0.35
15 0.34
16 0.36
17 0.35
18 0.38
19 0.39
20 0.36
21 0.42
22 0.44
23 0.41
24 0.38
25 0.38
26 0.35
27 0.35
28 0.34
29 0.29
30 0.23
31 0.2
32 0.19
33 0.18
34 0.24
35 0.21
36 0.2
37 0.19
38 0.18
39 0.23
40 0.24
41 0.28
42 0.22
43 0.24
44 0.23
45 0.25
46 0.26
47 0.2
48 0.2
49 0.18
50 0.18
51 0.16
52 0.16
53 0.15
54 0.14
55 0.13
56 0.12
57 0.1
58 0.1
59 0.1
60 0.1
61 0.08
62 0.09
63 0.1
64 0.08
65 0.09
66 0.1
67 0.12
68 0.13
69 0.15
70 0.18
71 0.2
72 0.27
73 0.32
74 0.35
75 0.35
76 0.41
77 0.42
78 0.41
79 0.4
80 0.33
81 0.28
82 0.23
83 0.22
84 0.16
85 0.19
86 0.25
87 0.27
88 0.33
89 0.37
90 0.42
91 0.42
92 0.41
93 0.43
94 0.39
95 0.38
96 0.33
97 0.29
98 0.24
99 0.25
100 0.24
101 0.19
102 0.21
103 0.2
104 0.21
105 0.23
106 0.23
107 0.21
108 0.25
109 0.23
110 0.18
111 0.15
112 0.15
113 0.16
114 0.25
115 0.34
116 0.35
117 0.42
118 0.49
119 0.54
120 0.56
121 0.58
122 0.55
123 0.54
124 0.53
125 0.49
126 0.44
127 0.39
128 0.36
129 0.3
130 0.26
131 0.16
132 0.13
133 0.09
134 0.06
135 0.05
136 0.05
137 0.05
138 0.04
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.06
148 0.07
149 0.07
150 0.07
151 0.09
152 0.1
153 0.11
154 0.13
155 0.15
156 0.23
157 0.27
158 0.27
159 0.27
160 0.27
161 0.28
162 0.28
163 0.3
164 0.27
165 0.31
166 0.32
167 0.32
168 0.37
169 0.39
170 0.47
171 0.53
172 0.56
173 0.59
174 0.67
175 0.77
176 0.79
177 0.85
178 0.84
179 0.84
180 0.85
181 0.85
182 0.85
183 0.84
184 0.83
185 0.82
186 0.79
187 0.73
188 0.71
189 0.72
190 0.68
191 0.68
192 0.67
193 0.6
194 0.56
195 0.56
196 0.5
197 0.46
198 0.49
199 0.51
200 0.55
201 0.61
202 0.61
203 0.64
204 0.66
205 0.65
206 0.59
207 0.55
208 0.51