Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YMN6

Protein Details
Accession A0A2T9YMN6    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-74STNIVKERKYRQYMNRRGGFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MIYFFLERRQLSAEKRKEDRESSEAYEEFDMTNLMGFSGFSTTKGKGVFGNHPGSTNIVKERKYRQYMNRRGGFNRPLDKID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.62
4 0.63
5 0.63
6 0.61
7 0.55
8 0.51
9 0.47
10 0.46
11 0.4
12 0.35
13 0.31
14 0.25
15 0.2
16 0.15
17 0.11
18 0.07
19 0.07
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.06
26 0.06
27 0.07
28 0.09
29 0.09
30 0.12
31 0.12
32 0.12
33 0.13
34 0.16
35 0.2
36 0.23
37 0.27
38 0.25
39 0.26
40 0.26
41 0.27
42 0.25
43 0.22
44 0.24
45 0.24
46 0.27
47 0.31
48 0.39
49 0.46
50 0.52
51 0.58
52 0.61
53 0.68
54 0.76
55 0.8
56 0.79
57 0.74
58 0.71
59 0.72
60 0.69
61 0.66
62 0.63