Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YLN7

Protein Details
Accession A0A2T9YLN7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
94-120FMARLKTKAGRKILKRRRMKGRRFLSHBasic
NLS Segment(s)
PositionSequence
88-117RKRKHGFMARLKTKAGRKILKRRRMKGRRF
Subcellular Location(s) mito 20.5, mito_nucl 12.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLLFRSLLVNCKTLASSARYTTLTCCKRLNPLLSASTSRSTPLLPRQVVPGSIFTKGALSLTPAFTTTTLQLRWRTYGQEYQPNQLQRKRKHGFMARLKTKAGRKILKRRRMKGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.22
4 0.23
5 0.26
6 0.25
7 0.26
8 0.29
9 0.36
10 0.34
11 0.34
12 0.35
13 0.33
14 0.4
15 0.46
16 0.46
17 0.39
18 0.39
19 0.38
20 0.38
21 0.39
22 0.33
23 0.28
24 0.24
25 0.22
26 0.18
27 0.16
28 0.17
29 0.22
30 0.27
31 0.26
32 0.27
33 0.3
34 0.3
35 0.3
36 0.27
37 0.25
38 0.18
39 0.18
40 0.17
41 0.14
42 0.13
43 0.12
44 0.11
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.09
52 0.09
53 0.1
54 0.09
55 0.11
56 0.11
57 0.15
58 0.18
59 0.19
60 0.22
61 0.22
62 0.23
63 0.24
64 0.3
65 0.31
66 0.37
67 0.37
68 0.39
69 0.43
70 0.46
71 0.48
72 0.48
73 0.54
74 0.51
75 0.6
76 0.59
77 0.59
78 0.62
79 0.66
80 0.7
81 0.71
82 0.76
83 0.72
84 0.71
85 0.68
86 0.66
87 0.63
88 0.61
89 0.6
90 0.58
91 0.61
92 0.7
93 0.78
94 0.82
95 0.85
96 0.87
97 0.89
98 0.9
99 0.91
100 0.9